anti-Human PDGFD antibody for Immunohistochemistry

Recommended PDGFD Antibody (supplied by: Log in to see )

Antigen
Platelet Derived Growth Factor D (PDGFD) Antibodies
  • IEGF
  • SCDGF-B
  • SCDGFB
  • Scdgfb
  • rSCDGF-B
  • PDGFD
  • 1110003I09Rik
  • platelet derived growth factor D
  • platelet-derived growth factor, D polypeptide
  • PDGFD
  • Pdgfd
Reactivity
Human
68
24
22
3
2
2
2
1
1
Host
Rabbit
62
9
1
Clonality
Polyclonal
Conjugate
This PDGFD antibody is un-conjugated
4
4
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
25
25
25
13
7
7
6
6
4
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344544
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1869732 ICC IHC IP WB Rabbit IgG AA 19-370 Log in to see Polyclonal
1 ABIN1922554 IHC ELISA FITC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1922551 IHC ELISA Alkaline Phosphatase (AP) Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1922555 IHC ELISA PE Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1922552 IHC ELISA APC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1922556 IHC ELISA HRP Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2583007 ELISA IHC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1922553 IHC ELISA Biotin Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2337164 IHC ELISA PE Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2337165 IHC ELISA FITC Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2337166 IHC ELISA HRP Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2337167 IHC ELISA Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2337169 IHC ELISA APC Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN1090286 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1090287 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN2337168 IHC ELISA Alkaline Phosphatase (AP) Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2337170 IHC ELISA Biotin Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN5566072 FACS ICC IF IHC APC Rabbit AA 250-370 Log in to see Polyclonal
1 ABIN5566074 FACS ICC IF IHC FITC Rabbit AA 250-370 Log in to see Polyclonal
1 ABIN5566076 FACS ICC IF IHC PE Rabbit AA 250-370 Log in to see Polyclonal

General

Antigen Platelet Derived Growth Factor D (PDGFD) Antibodies
Reactivity Human
(68), (24), (22), (3), (2), (2), (2), (1), (1)
Host Rabbit
(62), (9), (1)
Clonality
Polyclonal
Conjugate This PDGFD antibody is un-conjugated
(4), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(25), (25), (25), (13), (7), (7), (6), (6), (4), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-PDGFD Antibody

Target Details PDGFD Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP

Target Details PDGFD

Product Details anti-PDGFD Antibody Application Details Handling Images back to top
Antigen
Alternative Name PDGF-D/SCDGFB (PDGFD Antibody Abstract)
Background Gene Symbol: PDGFD
Gene ID 80310
UniProt Q9GZP0
Pathways RTK Signaling, Platelet-derived growth Factor Receptor Signaling

Application Details

Product Details anti-PDGFD Antibody Target Details PDGFD Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PDGFD Antibody Target Details PDGFD Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PDGFD Antibody Target Details PDGFD Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Platelet Derived Growth Factor D (PDGFD) antibody (ABIN4344544) Immunohistochemistry: PDGF-D/SCDGFB Antibody [NBP2-38087] - Staining of human placent...