You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Ret Proto-Oncogene antibody for Immunocytochemistry

Recommended Ret Proto-Oncogene Antibody (supplied by: Log in to see )

Antigen
Ret Proto-Oncogene (RET) Antibodies
  • c-ret
  • c-Ret
  • CDHF12
  • CDHR16
  • cret
  • etID315074.13
  • HSCR1
  • MEN2A
  • MEN2B
  • MTC1
  • PTC
  • RET
  • ret-A
  • RET-ELE1
  • ret1
  • RET9
  • RET51
  • wu:fd13h01
  • X-ret
  • xret
Reactivity
Human
367
104
94
5
3
1
Host
Rabbit
241
125
5
1
1
1
Clonality
Polyclonal
Conjugate
This Ret Proto-Oncogene antibody is un-conjugated
16
14
14
12
11
11
8
7
7
6
5
5
5
5
5
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
253
146
87
60
60
51
24
10
5
5
3
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4350058
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0010082448 ABIN2884297 ICC IHC ELISA WB Rabbit IgG AA 881-930 Log in to see Polyclonal
0.0010082448 ABIN2744030 ICC Rabbit C-Term Log in to see Polyclonal
0.0010082448 ABIN2744032 ICC Rabbit C-Term Log in to see Polyclonal
0.0010082448 ABIN2744031 ICC Rabbit C-Term Log in to see Polyclonal
0.0010082448 ABIN4350057 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
0.0010082448 ABIN4350067 ICC IF IHC (p) WB Mouse IgM kappa Log in to see 188CT11-2-3
0.0010082448 ABIN2972089 ICC IF IHC WB Rabbit C-Term Log in to see Polyclonal
0.0010082448 ABIN2972087 ICC IF IHC WB Rabbit C-Term Log in to see Polyclonal
0.0010082448 ABIN2972091 ICC IF IHC WB Rabbit C-Term, pTyr1062 Log in to see Polyclonal

Top referenced anti-Ret Proto-Oncogene antibody for Immunocytochemistry

Similar anti-Ret Proto-Oncogene Antibodies

Application / Reactivity Human
ELISA 142 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 51 Antibodies
Immunochromatography (IC) 3 Antibodies
Immunocytochemistry (ICC) 10 Antibodies
Immunofluorescence (IF) 25 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 60 Antibodies
Immunohistochemistry (IHC) 88 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 61 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Proximity Ligation Assay (PLA) 3 Antibodies
Western Blotting (WB) 249 Antibodies

General

Antigen Ret Proto-Oncogene (RET) Antibodies
Reactivity Human
(367), (104), (94), (5), (3), (1)
Host Rabbit
(241), (125), (5), (1), (1), (1)
Clonality
Polyclonal
Conjugate This Ret Proto-Oncogene antibody is un-conjugated
(16), (14), (14), (12), (11), (11), (8), (7), (7), (6), (5), (5), (5), (5), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(253), (146), (87), (60), (60), (51), (24), (10), (5), (5), (3), (3), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Ret Proto-Oncogene Antibody

Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene Antibody (ABIN4350058) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Isotype IgG

Target Details Ret Proto-Oncogene

Product Details anti-Ret Proto-Oncogene Antibody Application Details Handling References for anti-Ret Proto-Oncogene Antibody (ABIN4350058) Images back to top
Antigen
Alternative Name Ret (RET Antibody Abstract)
Background Gene Symbol: RET
UniProt P07949
Research Area Signaling, Kinases/Phosphatases, Cancer, Tyrosine Kinases
Pathways RTK Signaling

Application Details

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Handling References for anti-Ret Proto-Oncogene Antibody (ABIN4350058) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details References for anti-Ret Proto-Oncogene Antibody (ABIN4350058) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ret Proto-Oncogene Antibody (ABIN4350058)

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling Images back to top
Product cited in:

Luo, Tsuchiya, Il Park, Fausel, Kanngurn, Welcsh, Dzieciatkowski, Wang, Grady: "RET is a potential tumor suppressor gene in colorectal cancer." in: Oncogene, Vol. 32, Issue 16, pp. 2037-47, 2013

Qundos, Hong, Tybring, Divers, Odeberg, Uhlen, Nilsson, Schwenk: "Profiling post-centrifugation delay of serum and plasma with antibody bead arrays." in: Journal of proteomics, Vol. 95, pp. 46-54, 2013

Images

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene Antibody (ABIN4350058) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ret Proto-Oncogene antibody (RET) (ABIN4350058) Immunohistochemistry-Paraffin: Ret Antibody [NBP1-84568] - Immunohistochemical staini...
Immunofluorescence (IF) image for anti-Ret Proto-Oncogene antibody (RET) (ABIN4350058) Immunocytochemistry/Immunofluorescence: Ret Antibody [NBP1-84568] - Analysis of human...