anti-Human RHEB antibody for Immunohistochemistry

Recommended RHEB Antibody (supplied by: Log in to see )

Antigen
Ras Homolog Enriched in Brain (RHEB) Antibodies
  • RHEB
  • rheb2
  • im:7161941
  • zgc:153231
  • RHEB2
  • Ras homolog, mTORC1 binding
  • Ras homolog, mTORC1 binding like 1
  • ras homolog enriched in brain
  • Ras homolog enriched in brain
  • RHEB
  • rheb
  • rhebl1
  • Rheb
Reactivity
Human
134
81
61
4
3
2
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
87
47
Clonality
Polyclonal
Conjugate
This RHEB antibody is un-conjugated
4
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
110
31
26
16
13
7
4
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4891953
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.297053 ABIN3032435 IHC ELISA WB Rabbit Ig Fraction AA 104-134 Log in to see Polyclonal
9.297053 ABIN2404000 IHC WB Rabbit IgG Log in to see Polyclonal
9.297053 ABIN1031063 IHC ELISA WB Rabbit Middle Region Log in to see Polyclonal
9.297053 ABIN2433457 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
9.297053 ABIN2425557 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.297053 ABIN2430735 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.297053 ABIN2431049 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.297053 ABIN2424077 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN2786819 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
1 ABIN1874601 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1003087 IHC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 4
1 ABIN3021602 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4350383 ELISA IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2351253 IHC ELISA WB Rabbit IgG C-Term, AA 111-142 Log in to see Polyclonal
1 ABIN2888141 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2894072 IHC WB Rabbit Log in to see Polyclonal
1 ABIN2351248 IHC WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2700681 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2959902 IF IHC ELISA WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN1585139 IHC ELISA WB Rabbit Log in to see Polyclonal

General

Antigen Ras Homolog Enriched in Brain (RHEB) Antibodies
Reactivity Human
(134), (81), (61), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(87), (47)
Clonality
Polyclonal
Conjugate This RHEB antibody is un-conjugated
(4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(110), (31), (26), (16), (13), (7), (4), (3), (1)
Supplier Log in to see

Product Details anti-RHEB Antibody

Target Details RHEB Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to RHEB(Ras homolog enriched in brain) The peptide sequence was selected from the middle region of RHEB. Peptide sequence VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA.

Target Details RHEB

Product Details anti-RHEB Antibody Application Details Handling Images back to top
Antigen
Alternative Name Rheb (RHEB Antibody Abstract)
Background Gene Symbol: RHEB
Gene ID 6009
UniProt Q15382
Pathways RTK Signaling

Application Details

Product Details anti-RHEB Antibody Target Details RHEB Handling Images back to top
Application Notes Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against RHEB and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RHEB Antibody Target Details RHEB Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-RHEB Antibody Target Details RHEB Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Ras Homolog Enriched in Brain (RHEB) antibody (ABIN4891953) Western Blot: Rheb Antibody [NBP1-58861] - Human Muscle lysate, concentration 0.2-1 u...
Immunohistochemistry (IHC) image for anti-Ras Homolog Enriched in Brain (RHEB) antibody (ABIN4891953) Immunohistochemistry: Rheb Antibody [NBP1-58861] - Formalin Fixed Paraffin Embedded T...