anti-Human SHC2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended SHC2 Antibody (supplied by: Log in to see )

Antigen
SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) Antibodies
  • SCK
  • SHCB
  • SLI
  • 6720466E06
  • ShcB
  • Sli
  • SHC (Src homology 2 domain containing) transforming protein 2
  • SHC2
  • Shc2
Reactivity
Human
36
25
24
4
1
Host
Rabbit
31
4
4
Clonality
Polyclonal
Conjugate
This SHC2 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
24
13
9
4
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4353346
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1413314 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1395421 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN1386708 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

General

Antigen SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) Antibodies
Reactivity Human
(36), (25), (24), (4), (1)
Host Rabbit
(31), (4), (4)
Clonality
Polyclonal
Conjugate This SHC2 antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(24), (13), (9), (4), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-SHC2 Antibody

Target Details SHC2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERMLRADGD
Isotype IgG

Target Details SHC2

Product Details anti-SHC2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SHC2 (SHC2 Antibody Abstract)
Background Gene Symbol: SHC2
Gene ID 25759
Research Area Neurology
Pathways RTK Signaling, Neurotrophin Signaling Pathway, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals, VEGF Signaling

Application Details

Product Details anti-SHC2 Antibody Target Details SHC2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SHC2 Antibody Target Details SHC2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SHC2 Antibody Target Details SHC2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Immunohistochemistry-Paraffin: SHC2 Antibody [NBP1-87076] - Staining of human hippoca...
Western Blotting (WB) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Western Blot: SHC2 Antibody [NBP1-87076] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32,...
Immunofluorescence (IF) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Immunocytochemistry/Immunofluorescence: SHC2 Antibody [NBP1-87076] - Immunofluorescen...