You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) TSC2 antibody for Immunocytochemistry

Recommended TSC2 Antibody (supplied by: Log in to see )

Antigen
Tuberous Sclerosis 2 (TSC2) Antibodies
  • TSC2
  • fc16b02
  • tuberin
  • wu:fc16b02
  • LAM
  • TSC4
  • Nafld
  • Tcs2
  • Rc
  • tuberous sclerosis 2
  • tuberous sclerosis complex 2 (TSC2)
  • TSC2
  • AaeL_AAEL007712
  • tsc2
  • PGTG_00159
  • Tsc2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
536
387
210
6
Host
Rabbit
718
25
Clonality
Polyclonal
Conjugate
This TSC2 antibody is un-conjugated
51
51
51
43
42
42
10
10
9
9
9
9
9
9
9
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
387
302
222
147
101
73
62
22
7
7
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN4363062
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3068124 ICC IF IHC WB Rabbit C-Term, pThr1462 Log in to see Polyclonal

Similar anti-TSC2 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
Dot Blot (DB) 20 Antibodies 160 Antibodies
ELISA 48 Antibodies 165 Antibodies
Immunochromatography (IC) 2 Antibodies 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies 8 Antibodies
Immunofluorescence (IF) 9 Antibodies 18 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 101 Antibodies
Immunohistochemistry (IHC) 47 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 39 Antibodies
Western Blotting (WB) 70 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies

General

Antigen Tuberous Sclerosis 2 (TSC2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(536), (387), (210), (6)
Host Rabbit
(718), (25)
Clonality
Polyclonal
Conjugate This TSC2 antibody is un-conjugated
(51), (51), (51), (43), (42), (42), (10), (10), (9), (9), (9), (9), (9), (9), (9), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(387), (302), (222), (147), (101), (73), (62), (22), (7), (7), (4), (2), (1)
Supplier Log in to see

Product Details anti-TSC2 Antibody

Target Details TSC2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE
Isotype IgG

Target Details TSC2

Product Details anti-TSC2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name TSC2 (TSC2 Antibody Abstract)
Background Gene Symbol: TSC2
Gene ID 7249
Pathways RTK Signaling, AMPK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-TSC2 Antibody Target Details TSC2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TSC2 Antibody Target Details TSC2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.