anti-Rat (Rattus) TECTA antibody for Western Blotting

Recommended TECTA Antibody (supplied by: Log in to see )

Antigen
Tectorin alpha (TECTA) Antibodies
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • TECTA
  • Tecta
Epitope
AA 93-134, N-Term
3
2
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
7
Host
Rabbit
5
2
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
5
5
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN5518790
$ 357.50
Plus shipping costs $45.00

Similar anti-TECTA Antibodies

Application / Reactivity Human Mouse (Murine) Rat (Rattus)
Western Blotting (WB) 6 Antibodies 1 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies 1 Antibodies 1 Antibodies
Immunohistochemistry (IHC) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
ELISA (Capture) 1 Antibodies
ELISA 5 Antibodies

General

Antigen Tectorin alpha (TECTA) Antibodies
Epitope AA 93-134, N-Term
(3), (2), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(7)
Host Rabbit
(5), (2)
Clonality
Polyclonal
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(5), (5), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-TECTA Antibody

Target Details TECTA Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tectorin alpha
Protein Name: Alpha-tectorin
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
Isotype IgG

Target Details TECTA

Product Details anti-TECTA Antibody Application Details Handling Images back to top
Antigen
Alternative Name TECTA (TECTA Antibody Abstract)
Background Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

Synonyms: Alpha-tectorin | DFNA12 | DFNA8 | DFNB21 | TECTA | O75443
Gene ID 7007
UniProt O75443
Pathways Sensory Perception of Sound

Application Details

Product Details anti-TECTA Antibody Target Details TECTA Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-TECTA Antibody Target Details TECTA Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.