You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) CBL antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CBL Antibody (supplied by: Log in to see )

Antigen
Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence (CBL) Antibodies
  • 4732447J05Rik
  • C-CBL
  • c-Cbl
  • c-cbl-like
  • cbl
  • Cbl-2
  • CBL2
  • FRA11B
  • NSLL
  • RGD1561386
  • RNF55
Reactivity
Human, Mouse (Murine), Rat (Rattus)
248
135
128
6
4
4
4
1
1
1
Host
Rabbit
200
36
17
1
Clonality
Polyclonal
Conjugate
This CBL antibody is un-conjugated
7
7
7
7
6
5
5
5
5
5
5
5
4
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
168
71
68
55
54
32
17
16
6
5
4
3
3
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4288402
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008921381 ABIN271926 IHC (p) WB Rabbit Log in to see Polyclonal
0.0008921381 ABIN271925 IF IHC (p) WB Rabbit Log in to see Polyclonal
0.0008921381 ABIN272004 IF IHC (p) WB Rabbit Log in to see Polyclonal
0.0008921381 ABIN1105707 EIA IF IHC (p) WB Mouse IgG1 Log in to see 3B12 3
0.0008921381 ABIN753403 IF (p) IHC (p) WB Rabbit IgG pTyr674 Log in to see Polyclonal
0.0008921381 ABIN1732715 IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal
0.0008921381 ABIN683970 IHC (p) WB Biotin Rabbit IgG pTyr731 Log in to see Polyclonal
0.0008921381 ABIN683985 IHC (p) WB Biotin Rabbit IgG pTyr774 Log in to see Polyclonal
0.0008921381 ABIN753405 IHC (p) WB Biotin Rabbit IgG pTyr674 Log in to see Polyclonal
0.0008921381 ABIN753412 IHC (p) WB HRP Rabbit IgG pTyr674 Log in to see Polyclonal
0.0008921381 ABIN753420 IHC (p) WB Biotin Rabbit IgG pTyr700 Log in to see Polyclonal
0.0008921381 ABIN753427 IHC (p) WB HRP Rabbit IgG pTyr700 Log in to see Polyclonal
0.0008921381 ABIN683977 IHC (p) WB HRP Rabbit IgG pTyr731 Log in to see Polyclonal
0.0008921381 ABIN683992 IHC (p) WB HRP Rabbit IgG pTyr774 Log in to see Polyclonal
0.0008921381 ABIN407934 IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
0.0008921381 ABIN683968 IF (p) IHC (p) WB Rabbit IgG pTyr731 Log in to see Polyclonal
0.0008921381 ABIN753418 IF (p) IHC (p) WB Rabbit IgG pTyr700 Log in to see Polyclonal
0.0008921381 ABIN755544 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.0008921381 ABIN755551 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.0008921381 ABIN683983 IF (p) IHC (p) WB Rabbit IgG pTyr774 Log in to see Polyclonal

Top referenced anti-CBL antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-CBL Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 31 Antibodies 35 Antibodies
Enzyme Immunoassay (EIA) 4 Antibodies 4 Antibodies
Flow Cytometry (FACS) 4 Antibodies 4 Antibodies
Fluorescence Microscopy (FM) 1 Antibodies 1 Antibodies
Immunochromatography (IC) 2 Antibodies 2 Antibodies
Immunocytochemistry (ICC) 6 Antibodies 6 Antibodies
Immunofluorescence (IF) 27 Antibodies 27 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 55 Antibodies
Immunohistochemistry (IHC) 37 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 23 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 74 Antibodies

General

Antigen Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence (CBL) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(248), (135), (128), (6), (4), (4), (4), (1), (1), (1)
Host Rabbit
(200), (36), (17), (1)
Clonality
Polyclonal
Conjugate This CBL antibody is un-conjugated
(7), (7), (7), (7), (6), (5), (5), (5), (5), (5), (5), (5), (4), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(168), (71), (68), (55), (54), (32), (17), (16), (6), (5), (4), (3), (3), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CBL Antibody

Target Details CBL Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Isotype IgG

Target Details CBL

Product Details anti-CBL Antibody Application Details Handling Images back to top
Antigen
Alternative Name CBL (CBL Antibody Abstract)
Background Gene Symbol: CBL
Research Area Proteolysis / Ubiquitin, Transcription Factors, Cancer
Pathways TCR Signaling, Interferon-gamma Pathway, EGFR Signaling Pathway

Application Details

Product Details anti-CBL Antibody Target Details CBL Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CBL Antibody Target Details CBL Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CBL Antibody Target Details CBL Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-CBL antibody (Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence) (ABIN4288402) Immunocytochemistry/Immunofluorescence: CBL Antibody [NBP1-86588] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CBL antibody (Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence) (ABIN4288402) Immunohistochemistry-Paraffin: CBL Antibody [NBP1-86588] - Staining of human tonsil s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CBL antibody (Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence) (ABIN4288402) Immunohistochemistry-Paraffin: CBL Antibody [NBP1-86588] - Staining of human tonsil s...
Western Blotting (WB) image for anti-CBL antibody (Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence) (ABIN4288402) Western Blot: CBL Antibody [NBP1-86588] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, ...
Western Blotting (WB) image for anti-CBL antibody (Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence) (ABIN4288402) Western Blot: CBL Antibody [NBP1-86588] - Lane 1: NIH-3T3 cell lysate (Mouse embryoni...