anti-Human CD137 antibody for Immunofluorescence

Recommended CD137 Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9) Antibodies
  • TNFRSF9
  • zgc:136557
  • 4-1BB
  • CD137
  • CDw137
  • ILA
  • A930040I11Rik
  • AA408498
  • AI325004
  • Cd137
  • Ly63
  • tumor necrosis factor receptor superfamily, member 9
  • tumor necrosis factor receptor superfamily, member 9a
  • TNFRSF9
  • tnfrsf9a
  • LOC100348914
  • Tnfrsf9
Reactivity
Human
216
128
21
15
14
10
3
2
2
2
2
2
Host
Rabbit
119
105
55
27
19
Clonality
Polyclonal
Conjugate
This CD137 antibody is un-conjugated
29
23
15
11
11
10
9
6
6
6
6
6
6
5
4
4
4
4
4
4
4
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
211
138
97
21
17
17
13
12
8
7
5
5
3
2
2
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5074777
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3183733 ELISA IF WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2663017 FACS IF PE Mouse IgG1 kappa Log in to see 4B4-1 8
1 ABIN272217 IF WB Rabbit Log in to see Polyclonal
1 ABIN2663018 FACS IF PE Mouse IgG1 kappa Log in to see 4B4-1 8
1 ABIN2755639 IC IF WB Rabbit Center Log in to see Polyclonal
1 ABIN2892148 IF WB Rabbit Lys107 Log in to see Polyclonal
1 ABIN386192 FACS IF Mouse IgG1, kappa Ectodomain Log in to see BBK-2
1 ABIN2629449 FACS IF IHC (p) Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386190 FACS IF Biotin Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386189 FACS IF Biotin Mouse IgG1, kappa Log in to see BBK-2
1 ABIN2222685 FACS IF Mouse IgG1 kappa Log in to see 0-N-185
1 ABIN386188 FACS IF Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386186 FACS IF Mouse IgG1, kappa Log in to see BBK-2
1 ABIN2222687 FACS IF Mouse IgG1 kappa Ectodomain Log in to see 0-N-185
1 ABIN5589849 IF WB Rabbit Log in to see Polyclonal

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9) Antibodies
Reactivity Human
(216), (128), (21), (15), (14), (10), (3), (2), (2), (2), (2), (2)
Host Rabbit
(119), (105), (55), (27), (19)
Clonality
Polyclonal
Conjugate This CD137 antibody is un-conjugated
(29), (23), (15), (11), (11), (10), (9), (6), (6), (6), (6), (6), (6), (5), (4), (4), (4), (4), (4), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(211), (138), (97), (21), (17), (17), (13), (12), (8), (7), (5), (5), (3), (2), (2), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-CD137 Antibody

Target Details CD137 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Isotype IgG

Target Details CD137

Product Details anti-CD137 Antibody Application Details Handling Images back to top
Antigen
Alternative Name 4-1BB/TNFRSF9/CD137 (TNFRSF9 Antibody Abstract)
Background Gene Symbol: TNFRSF9
Gene ID 3604

Application Details

Product Details anti-CD137 Antibody Target Details CD137 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD137 Antibody Target Details CD137 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CD137 Antibody Target Details CD137 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9) antibody (ABIN5074777) Immunocytochemistry/Immunofluorescence: 4-1BB/TNFRSF9/CD137 Antibody - Staining of h...