anti-Human CD137 antibody for Immunofluorescence

Recommended CD137 Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9) Antibodies
  • TNFRSF9
  • zgc:136557
  • 4-1BB
  • CD137
  • CDw137
  • ILA
  • A930040I11Rik
  • AA408498
  • AI325004
  • Cd137
  • Ly63
  • tumor necrosis factor receptor superfamily, member 9
  • tumor necrosis factor receptor superfamily, member 9a
  • TNFRSF9
  • tnfrsf9a
  • LOC100348914
  • Tnfrsf9
Reactivity
Human
202
110
21
15
14
10
3
2
2
2
2
2
Host
Rabbit
106
87
54
27
19
Clonality
Polyclonal
Conjugate
This CD137 antibody is un-conjugated
26
23
14
9
9
8
7
5
4
4
4
4
4
4
4
4
4
4
3
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
207
105
96
21
17
17
13
12
7
5
5
3
2
2
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5074777
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3183733 ELISA IF WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2663017 FACS IF PE Mouse IgG1 kappa Log in to see 4B4-1 8
1 ABIN272217 IF WB Rabbit Log in to see Polyclonal
1 ABIN2663018 FACS IF PE Mouse IgG1 kappa Log in to see 4B4-1 8
1 ABIN180377 FACS IF Mouse IgG1 Log in to see BBK-2
1 ABIN2755639 IC IF WB Rabbit Center Log in to see Polyclonal
1 ABIN386189 FACS IF Biotin Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386190 FACS IF Biotin Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386192 FACS IF Mouse IgG1, kappa Ectodomain Log in to see BBK-2
1 ABIN2629449 FACS IF IHC (p) Mouse IgG1, kappa Log in to see BBK-2
1 ABIN2892148 IF WB Rabbit Lys107 Log in to see Polyclonal
1 ABIN2222685 FACS IF Mouse IgG1 kappa Log in to see 0-N-185
1 ABIN386188 FACS IF Mouse IgG1, kappa Log in to see BBK-2
1 ABIN386186 FACS IF Mouse IgG1, kappa Log in to see BBK-2
1 ABIN2222687 FACS IF Mouse IgG1 kappa Ectodomain Log in to see 0-N-185

Top referenced anti-CD137 antibody for Immunofluorescence

Similar anti-CD137 Antibodies

Application / Reactivity Human
Agonist (Agon) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 94 Antibodies
ELISA (Capture) 1 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 118 Antibodies
Functional Studies (Func) 18 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 16 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 9 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Immunoprecipitation (IP) 14 Antibodies
Neutralization (Neut) 1 Antibodies

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 9 (TNFRSF9) Antibodies
Reactivity Human
(202), (110), (21), (15), (14), (10), (3), (2), (2), (2), (2), (2)
Host Rabbit
(106), (87), (54), (27), (19)
Clonality
Polyclonal
Conjugate This CD137 antibody is un-conjugated
(26), (23), (14), (9), (9), (8), (7), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(207), (105), (96), (21), (17), (17), (13), (12), (7), (5), (5), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD137 Antibody

Target Details CD137 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Isotype IgG

Target Details CD137

Product Details anti-CD137 Antibody Application Details Handling Images back to top
Antigen
Alternative Name 4-1BB/TNFRSF9/CD137 (TNFRSF9 Antibody Abstract)
Background Gene Symbol: TNFRSF9
Gene ID 3604

Application Details

Product Details anti-CD137 Antibody Target Details CD137 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD137 Antibody Target Details CD137 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CD137 Antibody Target Details CD137 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-CD137 antibody (Tumor Necrosis Factor Receptor Superfamily, Member 9) (ABIN5074777) Immunocytochemistry/Immunofluorescence: 4-1BB/TNFRSF9/CD137 Antibody - Staining of h...