anti-Human CD247 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CD247 Antibody (supplied by: Log in to see )

Antigen
CD247 Molecule (CD247) Antibodies
  • im:7156386
  • LOC100136514
  • CD3Z
  • LOC100136549
  • LOC100305023
  • CD247
  • 4930549J05Rik
  • A430104F18Rik
  • AW552088
  • Cd3
  • Cd3-eta
  • Cd3-zeta
  • Cd3h
  • Cd3z
  • Cd3zeta
  • T3z
  • Tcrk
  • Tcrz
  • CD3-ZETA
  • CD3H
  • CD3Q
  • T3Z
  • TCRZ
  • TCRzeta
  • CD247 antigen like
  • CD3zeta-2
  • CD3zeta-1
  • CD3 zeta
  • CD247 molecule
  • CD247 antigen
  • Cd247 molecule
  • cd247l
  • LOC100136514
  • LOC100136549
  • LOC100305023
  • CD247
  • cd247
  • Cd247
Reactivity
Human
258
193
40
5
4
4
1
1
1
1
1
Host
Rabbit
141
100
42
30
14
3
Clonality
Polyclonal
Conjugate
This CD247 antibody is un-conjugated
27
16
12
11
11
10
8
8
7
6
6
6
4
4
4
4
4
4
4
4
3
3
3
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
206
194
107
51
45
40
35
23
9
7
4
4
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4291760
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.671394 ABIN4291754 ELISA FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 4B10
1 ABIN115429 IHC (fro) IHC (p) Rabbit AA 36-54 Log in to see Polyclonal 5
1 ABIN1106130 IHC (fro) IHC (p) Rabbit IgG1 Log in to see MRQ-39 1
1 ABIN1689210 IHC (p) Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN782349 EIA IHC (p) IP WB Mouse IgG1 AA 1-165 Log in to see 4A12-F6
1 ABIN1689175 IHC (p) Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN272006 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1106129 EIA IF IHC (p) WB Mouse IgG1 Log in to see 4B10 2
1 ABIN115430 IHC (fro) IHC (p) Rabbit AA 36-54 Log in to see Polyclonal
1 ABIN574071 FACS IF IHC (p) ELISA WB Mouse IgG1 Log in to see 4B10
1 ABIN790464 IHC (p) IP ELISA WB Mouse IgG1, kappa AA 1-165 Log in to see 4A12-F6
1 ABIN5552374 IHC (p) IP Rabbit Log in to see Polyclonal
1 ABIN4291753 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal
1 ABIN560227 IHC (p) IP ELISA WB Mouse IgG1 kappa AA 1-164, full length Log in to see 4A12-F6
1 ABIN1723823 IHC (p) IP ELISA WB Mouse IgG1 kappa AA 1-165, full length Log in to see 4A12-F6
1 ABIN4291750 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal
1 ABIN4291751 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal
1 ABIN4291752 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal
1 ABIN5574275 ELISA FACS IF IHC (p) WB Mouse IgG1 Log in to see 4B10
1 ABIN5574276 ELISA FACS IHC (p) Mouse IgG2a Log in to see 4D10A6

General

Antigen CD247 Molecule (CD247) Antibodies
Reactivity Human
(258), (193), (40), (5), (4), (4), (1), (1), (1), (1), (1)
Host Rabbit
(141), (100), (42), (30), (14), (3)
Clonality
Polyclonal
Conjugate This CD247 antibody is un-conjugated
(27), (16), (12), (11), (11), (10), (8), (8), (7), (6), (6), (6), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(206), (194), (107), (51), (45), (40), (35), (23), (9), (7), (4), (4), (3), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-CD247 Antibody

Target Details CD247 Application Details Handling References for anti-CD247 antibody (ABIN4291760) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
Isotype IgG

Target Details CD247

Product Details anti-CD247 Antibody Application Details Handling References for anti-CD247 antibody (ABIN4291760) Images back to top
Antigen
Alternative Name CD3 zeta (CD247 Antibody Abstract)
Background Gene Symbol: CD247
Gene ID 919
Research Area Adaptive Immunity, Immunology, Surface Receptors of Immune Cells, CD Antigens
Pathways TCR Signaling, CXCR4-mediated Signaling Events

Application Details

Product Details anti-CD247 Antibody Target Details CD247 Handling References for anti-CD247 antibody (ABIN4291760) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD247 Antibody Target Details CD247 Application Details References for anti-CD247 antibody (ABIN4291760) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-CD247 antibody (ABIN4291760)

Product Details anti-CD247 Antibody Target Details CD247 Application Details Handling Images back to top
Product cited in:

Grundy, Plumb, Lea, Kaur, Ray, Singh: "Down regulation of T cell receptor expression in COPD pulmonary CD8 cells." in: PLoS ONE, Vol. 8, Issue 8, pp. e71629, 2013

Images

Product Details anti-CD247 Antibody Target Details CD247 Application Details Handling References for anti-CD247 antibody (ABIN4291760) back to top
Supplier Images
Immunocytochemistry (ICC) image for anti-CD247 Molecule (CD247) antibody (ABIN4291760) Immunocytochemistry: CD3 zeta Antibody [NBP1-85750] - Staining of unstimulated human ...
Western Blotting (WB) image for anti-CD247 Molecule (CD247) antibody (ABIN4291760) Western Blot: CD3 zeta Antibody [NBP1-85750] - Lane 1: Marker [kDa] 230, 130, 95, 72,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD247 Molecule (CD247) antibody (ABIN4291760) Immunohistochemistry-Paraffin: CD3 zeta Antibody [NBP1-85750] - Staining of human lym...