anti-Human CrkL antibody for Immunocytochemistry

Recommended CrkL Antibody (supplied by: Log in to see )

Antigen
V-Crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like (CRKL) Antibodies
  • CRKL
  • wu:fa55g05
  • wu:fj60e01
  • zgc:63469
  • 1110025F07Rik
  • AA589403
  • AI325100
  • Crkol
  • v-crk sarcoma virus CT10 oncogene homolog (avian)-like
  • v-crk avian sarcoma virus CT10 oncogene homolog-like
  • CRKL
  • crkl
  • LOC100342327
  • Crkl
Reactivity
Human
168
89
66
3
3
3
2
1
1
1
1
1
1
Host
Rabbit
122
43
22
1
Clonality
Polyclonal
Conjugate
This CrkL antibody is un-conjugated
9
8
8
7
6
5
4
4
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
150
74
30
25
24
21
17
4
4
4
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076105
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1867385 ICC IHC IP WB Rabbit IgG AA 1-303 Log in to see Polyclonal
1 ABIN5567019 FACS ICC IF IHC FITC Rabbit AA 1-303 Log in to see Polyclonal
1 ABIN5567021 FACS ICC IF IHC PE Rabbit AA 1-303 Log in to see Polyclonal
1 ABIN5567017 FACS ICC IF IHC APC Rabbit AA 1-303 Log in to see Polyclonal

General

Antigen V-Crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like (CRKL) Antibodies
Reactivity Human
(168), (89), (66), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(122), (43), (22), (1)
Clonality
Polyclonal
Conjugate This CrkL antibody is un-conjugated
(9), (8), (8), (7), (6), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(150), (74), (30), (25), (24), (21), (17), (4), (4), (4), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-CrkL Antibody

Target Details CrkL Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE
Isotype IgG

Target Details CrkL

Product Details anti-CrkL Antibody Application Details Handling Images back to top
Antigen
Alternative Name CrkL (CRKL Antibody Abstract)
Background Gene Symbol: CRKL
Gene ID 1399
Research Area Transcription Factors, Cancer
Pathways Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-CrkL Antibody Target Details CrkL Handling Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CrkL Antibody Target Details CrkL Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CrkL Antibody Target Details CrkL Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-V-Crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like (CRKL) antibody (ABIN5076105) Immunocytochemistry/Immunofluorescence: CrkL Antibody - Staining of human cell line ...
Western Blotting (WB) image for anti-V-Crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like (CRKL) antibody (ABIN5076105) Western Blot: CrkL Antibody - Western blot analysis in human cell line RT-4.