anti-Human IRF4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IRF4 Antibody (supplied by: Log in to see )

Antigen
Interferon Regulatory Factor 4 (IRF4) Antibodies
  • IRF4
  • irf4
  • LSIRF
  • MUM1
  • NF-EM5
  • AI385587
  • IRF-4
  • Spip
  • si:ch73-170d1.2
  • interferon regulatory factor 4
  • Interferon regulatory factor 4
  • interferon regulatory factor 4a
  • melanoma associated antigen (mutated) 1
  • IRF4
  • irf4
  • LOC100223845
  • Irf4
  • irf4a
  • MUM1
Reactivity
Human
139
48
25
5
5
5
4
4
4
3
2
2
2
2
1
Host
Rabbit
89
25
17
9
2
Clonality
Polyclonal
Conjugate
This IRF4 antibody is un-conjugated
3
2
2
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
121
53
35
29
18
16
9
4
3
3
3
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4327577
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.588177 ABIN4327576 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN3042469 IHC (p) WB Rabbit IgG AA 272-451 Log in to see Polyclonal
1 ABIN115258 IHC (fro) IHC (p) Mouse IgG1 Log in to see MUM1p 2
1 ABIN1687911 IHC (p) Rabbit IgG C-Term Log in to see SP114
1 ABIN1687892 IHC (p) WB Rabbit IgG C-Term Log in to see SP114
1 ABIN324447 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1107883 IHC (fro) IHC (p) Mouse IgG1 Log in to see KBA-62 4
1 ABIN614626 EIA IHC (p) WB Mouse IgG2a AA 342-452 Log in to see 2F2
1 ABIN574287 IHC (p) ELISA WB Mouse IgG2a, kappa AA 342-452 Log in to see 2F2
1 ABIN959648 IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN115257 IHC (fro) IHC (p) Mouse IgG1 Log in to see MUM1p
1 ABIN317672 IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1736024 ICC IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN5551070 IHC (p) WB Rabbit IgG C-Term Log in to see SP114
1 ABIN2624266 IHC (p) WB Rabbit IgG AA 272-451 Log in to see Polyclonal
1 ABIN561524 IHC (p) ELISA WB Mouse IgG2a kappa AA 342-451, partial Log in to see 2F2
1 ABIN1822597 IHC (p) Mouse IgG1 Log in to see FIB504
1 ABIN3031419 IHC (p) WB Rabbit IgG AA 272-451 Log in to see Polyclonal
1 ABIN1723487 IHC (p) ELISA WB Mouse IgG2a kappa AA 342-452 Log in to see 2F2
1 ABIN1905798 IHC (p) WB Rabbit IgG C-Term Log in to see SP114

General

Antigen Interferon Regulatory Factor 4 (IRF4) Antibodies
Reactivity Human
(139), (48), (25), (5), (5), (5), (4), (4), (4), (3), (2), (2), (2), (2), (1)
Host Rabbit
(89), (25), (17), (9), (2)
Clonality
Polyclonal
Conjugate This IRF4 antibody is un-conjugated
(3), (2), (2), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(121), (53), (35), (29), (18), (16), (9), (4), (3), (3), (3), (3), (1)
Supplier Log in to see

Product Details anti-IRF4 Antibody

Target Details IRF4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPE
Isotype IgG

Target Details IRF4

Product Details anti-IRF4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IRF4 (IRF4 Antibody Abstract)
Background Gene Symbol: IRF4
Gene ID 3662
Pathways Chromatin Binding

Application Details

Product Details anti-IRF4 Antibody Target Details IRF4 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IRF4 Antibody Target Details IRF4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IRF4 Antibody Target Details IRF4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interferon Regulatory Factor 4 (IRF4) antibody (ABIN4327577) Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82814] - Staining of human tonsil ...
Western Blotting (WB) image for anti-Interferon Regulatory Factor 4 (IRF4) antibody (ABIN4327577) Western Blot: IRF4 Antibody [NBP1-82814] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-Interferon Regulatory Factor 4 (IRF4) antibody (ABIN4327577) Immunocytochemistry/Immunofluorescence: IRF4 Antibody [NBP1-82814] - Staining of huma...