anti-Human DAAM1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended DAAM1 Antibody (supplied by: Log in to see )

Antigen
Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
  • daam-1
  • xdaam1
  • DAAM1
  • DKFZp468D0524
  • 1700066F09Rik
  • 2310028E21Rik
  • AI503486
  • E130308H01
  • mKIAA0666
  • daam1
  • dishevelled associated activator of morphogenesis 1
  • dishevelled associated activator of morphogenesis 1a
  • daam1
  • DAAM1
  • Daam1
  • daam1a
Reactivity
Human
77
16
16
9
5
5
4
2
2
2
1
1
1
Host
Rabbit
71
6
Clonality
Polyclonal
Conjugate
This DAAM1 antibody is un-conjugated
5
5
5
5
5
5
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
73
49
45
10
9
5
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4304200
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN357856 EIA IHC (p) WB Rabbit Ig C-Term, N-Term Log in to see Polyclonal 3
1 ABIN651631 FACS IHC (p) WB Rabbit Ig AA 341-370, N-Term Log in to see Polyclonal 2
1 ABIN389179 IHC (p) WB Rabbit Ig AA 45-74, N-Term Log in to see Polyclonal 1
1 ABIN357855 EIA IHC (p) WB Rabbit Ig N-Term Log in to see Polyclonal 3
1 ABIN389180 IHC (p) WB Rabbit Ig AA 1034-1063, C-Term Log in to see Polyclonal 1
1 ABIN5530989 IHC (p) WB Rabbit Ig Fraction AA 45-74, N-Term Log in to see Polyclonal
1 ABIN5530990 IHC (p) WB Rabbit Ig Fraction AA 1034-1063, C-Term Log in to see Polyclonal
1 ABIN1840934 IHC (p) WB Rabbit AA 1034-1063 Log in to see Polyclonal
1 ABIN1813466 FACS IHC (p) WB Rabbit AA 341-370 Log in to see Polyclonal
1 ABIN2962470 IHC (p) WB Rabbit N-Term Log in to see Polyclonal

Top referenced anti-DAAM1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-DAAM1 Antibodies

Application / Reactivity Human
ELISA 49 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 9 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 6 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunohistochemistry (IHC) 46 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 11 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 73 Antibodies

General

Antigen Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
Reactivity Human
(77), (16), (16), (9), (5), (5), (4), (2), (2), (2), (1), (1), (1)
Host Rabbit
(71), (6)
Clonality
Polyclonal
Conjugate This DAAM1 antibody is un-conjugated
(5), (5), (5), (5), (5), (5)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(73), (49), (45), (10), (9), (5), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-DAAM1 Antibody

Target Details DAAM1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPG
Isotype IgG

Target Details DAAM1

Product Details anti-DAAM1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name DAAM1 (DAAM1 Antibody Abstract)
Background Gene Symbol: DAAM1
Gene ID 23002
Pathways WNT Signaling

Application Details

Product Details anti-DAAM1 Antibody Target Details DAAM1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-DAAM1 antibody (Dishevelled Associated Activator of Morphogenesis 1) (ABIN4304200) Immunocytochemistry/Immunofluorescence: DAAM1 Antibody [NBP1-81492] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DAAM1 antibody (Dishevelled Associated Activator of Morphogenesis 1) (ABIN4304200) Immunohistochemistry-Paraffin: DAAM1 Antibody [NBP1-81492] - Immunohistochemical stai...