anti-Human DKK4 antibody for Immunohistochemistry

Recommended DKK4 Antibody (supplied by: Log in to see )

Antigen
Dickkopf Homolog 4 (Xenopus Laevis) (DKK4) Antibodies
  • Dkk-4
  • DKK-4
  • RGD1563172
  • dickkopf homolog 4
  • dickkopf homolog 4 (Xenopus laevis)
  • dickkopf WNT signaling pathway inhibitor 4
  • dickkopf-related protein 4-like
  • LOC100356145
  • DKK4
  • Dkk4
  • LOC100623371
Reactivity
Human
96
19
10
2
2
2
1
1
1
Host
Rabbit
86
16
3
Clonality
Polyclonal
Conjugate
This DKK4 antibody is un-conjugated
8
8
7
7
7
7
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
98
62
34
8
3
2
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4305320
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.7958765 ABIN2421499 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1965072 IHC ELISA WB APC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1965074 IHC ELISA WB APC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1971486 IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1976085 IHC ELISA WB PE Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1976087 IHC ELISA WB PE Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1969166 IHC ELISA WB Biotin Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1969168 IHC ELISA WB Biotin Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1962695 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1962697 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1971488 IHC ELISA WB FITC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1973932 IHC ELISA WB HRP Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1973934 IHC ELISA WB HRP Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2598566 ELISA IHC WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2598565 ELISA IHC WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2253789 IHC ELISA WB FITC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2253792 IHC ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2253791 IHC ELISA WB PE Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2253790 IHC ELISA WB HRP Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2253801 IHC ELISA WB Rabbit IgG N-Term Log in to see Polyclonal

Similar anti-DKK4 Antibodies

Application / Reactivity Human
ELISA 58 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunohistochemistry (IHC) 33 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Western Blotting (WB) 89 Antibodies

General

Antigen Dickkopf Homolog 4 (Xenopus Laevis) (DKK4) Antibodies
Reactivity Human
(96), (19), (10), (2), (2), (2), (1), (1), (1)
Host Rabbit
(86), (16), (3)
Clonality
Polyclonal
Conjugate This DKK4 antibody is un-conjugated
(8), (8), (7), (7), (7), (7)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(98), (62), (34), (8), (3), (2), (2), (2)
Supplier Log in to see

Product Details anti-DKK4 Antibody

Target Details DKK4 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH
Isotype IgG

Target Details DKK4

Product Details anti-DKK4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Dkk-4 (DKK4 Antibody Abstract)
Background Gene Symbol: DKK4
Gene ID 27121
Pathways WNT Signaling

Application Details

Product Details anti-DKK4 Antibody Target Details DKK4 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DKK4 Antibody Target Details DKK4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DKK4 Antibody Target Details DKK4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-DKK4 antibody (Dickkopf Homolog 4 (Xenopus Laevis)) (ABIN4305320) Immunohistochemistry: Dkk-4 Antibody [NBP2-47484] - Analysis of human cerebellum show...