anti-Human DKK4 antibody for Immunohistochemistry

Recommended DKK4 Antibody (supplied by: Log in to see )

Dickkopf Homolog 4 (Xenopus Laevis) (DKK4) Antibodies
  • Dkk-4
  • DKK-4
  • RGD1563172
  • dickkopf homolog 4
  • dickkopf homolog 4 (Xenopus laevis)
  • dickkopf WNT signaling pathway inhibitor 4
  • dickkopf-related protein 4-like
  • LOC100356145
  • DKK4
  • Dkk4
  • LOC100623371
This DKK4 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4305320
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.900084 ABIN2421499 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1962695 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1962697 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1965072 IHC ELISA WB APC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1965074 IHC ELISA WB APC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1976085 IHC ELISA WB PE Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1976087 IHC ELISA WB PE Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1969166 IHC ELISA WB Biotin Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1971486 IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1971488 IHC ELISA WB FITC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1969168 IHC ELISA WB Biotin Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1973934 IHC ELISA WB HRP Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1973932 IHC ELISA WB HRP Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2598565 ELISA IHC WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2598566 ELISA IHC WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2253803 IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2253804 IHC ELISA WB HRP Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2253805 IHC ELISA WB PE Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2253787 IHC ELISA WB APC Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2253789 IHC ELISA WB FITC Rabbit IgG N-Term Log in to see Polyclonal


Antigen Dickkopf Homolog 4 (Xenopus Laevis) (DKK4) Antibodies
Reactivity Human
(110), (20), (10), (2), (2), (2), (1), (1), (1)
Host Rabbit
(87), (17), (16)
Conjugate This DKK4 antibody is un-conjugated
(9), (9), (8), (7), (7), (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(112), (76), (34), (8), (3), (2), (2), (2)
Supplier Log in to see

Product Details anti-DKK4 Antibody

Target Details DKK4 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH
Isotype IgG

Target Details DKK4

Product Details anti-DKK4 Antibody Application Details Handling Images back to top
Alternative Name Dkk-4 (DKK4 Antibody Abstract)
Background Gene Symbol: DKK4
Gene ID 27121
Pathways WNT Signaling

Application Details

Product Details anti-DKK4 Antibody Target Details DKK4 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-DKK4 Antibody Target Details DKK4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-DKK4 Antibody Target Details DKK4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Dickkopf Homolog 4 (Xenopus Laevis) (DKK4) antibody (ABIN4305320) Immunohistochemistry: Dkk-4 Antibody [NBP2-47484] - Analysis of human cerebellum show...