anti-Human FZD3 antibody for Immunocytochemistry

Recommended FZD3 Antibody (supplied by: Log in to see )

Antigen
Frizzled Family Receptor 3 (FZD3) Antibodies
  • FZD3
  • fz3
  • Fz-3
  • Xfz3
  • frz3
  • hfz3
  • frz-3
  • frizzled3
  • frizzled-3
  • FZ-3
  • AU020229
  • D930050A07Rik
  • Fz3
  • frizzled family receptor 3
  • frizzled homolog 3 (Drosophila)
  • FZD3
  • fzd3
  • Fzd3
Reactivity
Human
121
71
24
3
3
3
3
3
3
3
3
1
1
Host
Rabbit
81
23
16
7
Clonality
Polyclonal
Conjugate
This FZD3 antibody is un-conjugated
7
4
4
4
3
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
64
53
23
19
19
14
13
2
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076846
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN470848 ICC FACS IHC (fro) WB Biotin Rat IgG2a Cysteine-Rich Domain, Extracellular Log in to see

Similar anti-FZD3 Antibodies

Application / Reactivity Human
ELISA 51 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 20 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 20 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 9 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 19 Antibodies
Western Blotting (WB) 61 Antibodies

General

Antigen Frizzled Family Receptor 3 (FZD3) Antibodies
Reactivity Human
(121), (71), (24), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Host Rabbit
(81), (23), (16), (7)
Clonality
Polyclonal
Conjugate This FZD3 antibody is un-conjugated
(7), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(64), (53), (23), (19), (19), (14), (13), (2), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-FZD3 Antibody

Target Details FZD3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMT
Isotype IgG

Target Details FZD3

Product Details anti-FZD3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Frizzled-3 (FZD3 Antibody Abstract)
Background Gene Symbol: FZD3
Gene ID 7976
Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-FZD3 Antibody Target Details FZD3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-FZD3 antibody (Frizzled Family Receptor 3) (ABIN5076846) Western Blot: Frizzled-3 Antibody - Western blot analysis in human cell line RT-4, h...
Immunofluorescence (IF) image for anti-FZD3 antibody (Frizzled Family Receptor 3) (ABIN5076846) Immunocytochemistry/Immunofluorescence: Frizzled-3 Antibody - Staining of human cell...