anti-Human KREMEN1 antibody for Immunofluorescence

Recommended KREMEN1 Antibody (supplied by: Log in to see )

Kringle Containing Transmembrane Protein 1 (KREMEN1) Antibodies
  • krm1
  • kremen
  • kremem1
  • KRM1
  • AV002070
  • Kremen
  • Krm1
  • si:ct737139.1
  • si:dkeyp-7c9.1
  • kringle containing transmembrane protein 1
  • kremen1
  • Kremen1
This KREMEN1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077672
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2963239 IF IHC (p) ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1908740 IF IHC (p) ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN5582064 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2861030 IF IHC ELISA WB Rabbit C-Term Log in to see Polyclonal


Antigen Kringle Containing Transmembrane Protein 1 (KREMEN1) Antibodies
Reactivity Human
(73), (34), (14), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(68), (18), (5), (2)
Conjugate This KREMEN1 antibody is un-conjugated
(7), (7), (6), (6), (6), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(76), (55), (33), (17), (6), (4), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-KREMEN1 Antibody

Target Details KREMEN1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRN
Isotype IgG

Target Details KREMEN1

Product Details anti-KREMEN1 Antibody Application Details Handling Images back to top
Alternative Name Kremen-1 (KREMEN1 Antibody Abstract)
Background Gene Symbol: KREMEN1
Gene ID 83999
Pathways WNT Signaling

Application Details

Product Details anti-KREMEN1 Antibody Target Details KREMEN1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-KREMEN1 Antibody Target Details KREMEN1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-KREMEN1 Antibody Target Details KREMEN1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Kringle Containing Transmembrane Protein 1 (KREMEN1) antibody (ABIN5077672) Immunocytochemistry/Immunofluorescence: Kremen-1 Antibody - Staining of human cell l...