anti-Human LLGL2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended LLGL2 Antibody (supplied by: Log in to see )

Antigen
Lethal Giant Larvae Homolog 2 (Drosophila) (LLGL2) Antibodies
  • lgl-2
  • lgl2
  • hgl
  • Lgl-2
  • cb521
  • llglh2
  • sb:cb521
  • wu:fc06g08
  • wu:fl37c09
  • zgc:55895
  • HGL
  • LGL2
  • 9130006H11Rik
  • Llglh2
  • RGD1560307
  • lethal giant larvae homolog 2
  • lethal giant larvae homolog 2 (Drosophila)
  • llgl2
  • LLGL2
  • Llgl2
Reactivity
Human
36
9
7
Host
Rabbit
30
8
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
31
11
6
3
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4331215
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN561680 IHC (p) ELISA WB Mouse IgG2a kappa AA 101-199, partial Log in to see 4G2 6
1 ABIN2475345 IHC (p) Mouse IgG2a AA 101-200 Log in to see 4G2
1 ABIN1714392 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-LLGL2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-LLGL2 Antibodies

Application / Reactivity Human
ELISA 11 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 7 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Western Blotting (WB) 29 Antibodies

General

Antigen Lethal Giant Larvae Homolog 2 (Drosophila) (LLGL2) Antibodies
Reactivity Human
(36), (9), (7)
Host Rabbit
(30), (8)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(31), (11), (6), (3), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-LLGL2 Antibody

Target Details LLGL2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE
Isotype IgG

Target Details LLGL2

Product Details anti-LLGL2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name LLGL2 (LLGL2 Antibody Abstract)
Background Gene Symbol: LLGL2
Gene ID 3993
Pathways WNT Signaling

Application Details

Product Details anti-LLGL2 Antibody Target Details LLGL2 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LLGL2 Antibody Target Details LLGL2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-LLGL2 Antibody Target Details LLGL2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LLGL2 antibody (Lethal Giant Larvae Homolog 2 (Drosophila)) (ABIN4331215) Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human colon ...
Immunofluorescence (IF) image for anti-LLGL2 antibody (Lethal Giant Larvae Homolog 2 (Drosophila)) (ABIN4331215) Immunocytochemistry/Immunofluorescence: LLGL2 Antibody [NBP1-81753] Staining of human...