anti-Human PKC gamma antibody for Immunohistochemistry

Recommended PKC gamma Antibody (supplied by: Log in to see )

Antigen
Protein Kinase C, gamma (PRKCG) Antibodies
  • PRKCG
  • PKC-gamma
  • PKCC
  • PKCG
  • SCA14
  • PKCgamma
  • Pkcc
  • Prkcc
  • PKC
  • PKCI
  • Prkc
  • RATPKCI
  • protein kinase C, gamma
  • PRKCG
  • Prkcg
Reactivity
Human
141
125
107
7
7
6
4
4
4
3
2
2
2
1
Host
Rabbit
170
5
1
Clonality
Polyclonal
Conjugate
This PKC gamma antibody is un-conjugated
11
9
7
4
4
4
3
3
3
3
3
3
3
3
3
3
3
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
131
70
39
32
21
12
6
3
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4345845
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.673683 ABIN4345844 IHC IHC (p) Rabbit Log in to see Polyclonal
1 ABIN442501 IHC (p) IHC WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN2737419 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1926635 IHC ELISA WB Biotin Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1926636 IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1926637 IHC ELISA WB PE Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1926634 IHC ELISA WB APC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1926633 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN4345843 ELISA IHC IHC (fro) IHC (p) IP WB Rabbit IgG Log in to see A12-H
1 ABIN2576957 ELISA IHC WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1926638 IHC ELISA WB HRP Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341151 IHC ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341155 IHC ELISA WB FITC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341156 IHC ELISA WB HRP Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341157 IHC ELISA WB PE Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341153 IHC ELISA WB APC Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2342901 IHC ELISA WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2471819 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2341154 IHC ELISA WB Biotin Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2341152 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Log in to see Polyclonal

Similar anti-PKC gamma Antibodies

Application / Reactivity Human
Chromatin Immunoprecipitation (ChIP) 1 Antibodies
ELISA 47 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 39 Antibodies
Immunohistochemistry (IHC) 26 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 21 Antibodies
Immunoprecipitation (IP) 8 Antibodies
Radioimmunoassay (RIA) 1 Antibodies
Western Blotting (WB) 97 Antibodies

General

Antigen Protein Kinase C, gamma (PRKCG) Antibodies
Reactivity Human
(141), (125), (107), (7), (7), (6), (4), (4), (4), (3), (2), (2), (2), (1)
Host Rabbit
(170), (5), (1)
Clonality
Polyclonal
Conjugate This PKC gamma antibody is un-conjugated
(11), (9), (7), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(131), (70), (39), (32), (21), (12), (6), (3), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-PKC gamma Antibody

Target Details PKC gamma Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

Target Details PKC gamma

Product Details anti-PKC gamma Antibody Application Details Handling Images back to top
Antigen
Alternative Name PKC gamma (PRKCG Antibody Abstract)
Background Gene Symbol: PRKCG
Gene ID 5582
UniProt P05129
Research Area Neurology
Pathways WNT Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling

Application Details

Product Details anti-PKC gamma Antibody Target Details PKC gamma Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PKC gamma Antibody Target Details PKC gamma Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PKC gamma Antibody Target Details PKC gamma Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PKC gamma antibody (Protein Kinase C, gamma) (ABIN4345845) Immunohistochemistry: PKC gamma Antibody [NBP2-38728] - Staining of human cerebellum ...