You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Chemical Rhodopsin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Rhodopsin Antibody (supplied by: Log in to see )

Antigen
Rhodopsin (RHO) Antibodies
  • CG5279
  • DMELRH5
  • Dm Rh5
  • Dmel\\CG5279
  • RH5
  • Rh
  • rh5
  • CG9668
  • DMELRH4
  • Dm Rh4
  • Dmel\\CG9668
  • FBgn0003250
  • RH4
  • rh4
  • CG5192
  • DMELRH6
  • Dm Rh6
  • Dmel\\CG5192
  • R8
  • RH6
  • rh6
  • 143283_at
  • 1F9
  • BEST:GH11778
  • CG4550
  • DMELRH1
  • DRh1
  • Dm Rh1
  • DmRh1
  • Dmel\\CG4550
  • FBgn0002940
  • Nina E
  • NinaE
  • R
  • RH1
  • Rh-1
  • Rh1
  • Rh1(ninaE)
  • Rh1/ninaE
  • opsin
  • ora
  • rh1
  • rh1/ninaE
  • rhodopsin
  • CG10888
  • DMELRH3
  • Dm Rh3
  • Dmel\\CG10888
  • FBgn0003249
  • RH3
  • rh3
  • opn2
  • rp4
  • xrho
  • RHO
  • kfh-rh
  • RDP1
  • CSNBAD1
  • OPN2
  • RP4
  • Noerg1
  • Opn2
  • Ops
  • fi06d11
  • wu:fi06d11
  • zfo2
  • zfrho
  • PIGRHO1
  • ops
  • Rhodopsin 5
  • Rhodopsin 4
  • Rhodopsin 6
  • neither inactivation nor afterpotential E
  • Rhodopsin 3
  • rhodopsin
  • KFH-Rh protein
  • Rh5
  • Rh4
  • Rh6
  • ninaE
  • Rh3
  • RHO
  • rho
  • Rho
Reactivity
Chemical
230
5
5
4
4
2
1
1
1
Host
Rabbit
193
41
3
1
Clonality
Polyclonal
Conjugate
This Rhodopsin antibody is un-conjugated
12
10
10
8
8
6
6
5
5
5
5
5
5
5
4
4
4
4
4
4
4
4
4
4
4
4
3
3
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
225
153
149
149
117
92
46
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5079328
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN180439 IF IHC (p) WB Mouse IgG1 Log in to see RET-P1 4
1 ABIN267076 IF IHC IHC (p) WB Mouse IgG1 Log in to see RET-P1 1
1 ABIN272076 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN122407 IHC (p) Rabbit Log in to see Polyclonal
1 ABIN4350402 ELISA ICC IF IHC IHC (p) IP WB Mouse IgG1 Log in to see 1D4
1 ABIN1049292 IHC (p) Rabbit Extracellular Domain Log in to see Polyclonal
1 ABIN2888702 IHC (p) ELISA WB Rabbit IgG AA 299-348 Log in to see Polyclonal
1 ABIN2451717 IF IHC (p) WB Mouse IgG1 Log in to see RET-P1
1 ABIN1738860 IHC (p) Rabbit IgG 2nd Extracellular Domain Log in to see Polyclonal
1 ABIN1960117 ICC IF IHC (p) WB Mouse IgG1, kappa Log in to see B630
1 ABIN1960118 IF IHC (p) WB Mouse IgG1, kappa Log in to see A531
1 ABIN384471 IF IHC (p) WB Mouse IgG1 Log in to see RET-P1
1 ABIN4350412 ELISA ICC IF IHC IHC (p) IP WB Allophycocyanin Mouse IgG1 N-Term Log in to see 4D2
1 ABIN4350413 ELISA ICC IF IHC IHC (p) WB DyLight 755 Mouse IgG1 Log in to see 1D4
1 ABIN4350419 ELISA ICC IF IHC IHC (p) WB DyLight 680 Mouse IgG1 Log in to see 1D4
1 ABIN4350420 ELISA ICC IF IHC IHC (p) IP WB DyLight 680 Mouse IgG1 N-Term Log in to see 4D2
1 ABIN4350425 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see 1D4
1 ABIN4350429 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 Log in to see 1D4
1 ABIN4350430 ELISA ICC IF IHC IHC (p) IP WB Alexa Fluor 647 Mouse IgG1 N-Term Log in to see 4D2
1 ABIN4350405 ELISA ICC IF IHC IHC (p) WB DyLight 405 Mouse IgG1 Log in to see 1D4

Top referenced anti-Rhodopsin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Rhodopsin Antibodies

Application / Reactivity Chemical
ELISA 114 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 151 Antibodies
Immunofluorescence (IF) 147 Antibodies
Immunohistochemistry (IHC) 143 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 46 Antibodies
Immunoprecipitation (IP) 92 Antibodies
Western Blotting (WB) 218 Antibodies

General

Antigen Rhodopsin (RHO) Antibodies
Reactivity Chemical
(230), (5), (5), (4), (4), (2), (1), (1), (1)
Host Rabbit
(193), (41), (3), (1)
Clonality
Polyclonal
Conjugate This Rhodopsin antibody is un-conjugated
(12), (10), (10), (8), (8), (6), (6), (5), (5), (5), (5), (5), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(225), (153), (149), (149), (117), (92), (46), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-Rhodopsin Antibody

Target Details Rhodopsin Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Isotype IgG

Target Details Rhodopsin

Product Details anti-Rhodopsin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Rhodopsin (RHO Antibody Abstract)
Target Type Chemical
Background Gene Symbol: RHO
Gene ID 6010
Research Area Neurology
Pathways WNT Signaling, Sensory Perception of Sound, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction

Application Details

Product Details anti-Rhodopsin Antibody Target Details Rhodopsin Handling Images back to top
Application Notes Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Rhodopsin Antibody Target Details Rhodopsin Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Rhodopsin Antibody Target Details Rhodopsin Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Rhodopsin antibody (RHO) (ABIN5079328) Immunohistochemistry-Paraffin: Rhodopsin Antibody - Immunohistochemical staining of ...