You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human TCF4 antibody for Immunohistochemistry

Recommended TCF4 Antibody (supplied by: Log in to see )

Antigen
Transcription Factor 4 (TCF4) Antibodies
  • TCF7L2
  • TCF4
  • XE2
  • Xtcf-4
  • Xtcf4
  • e2-A
  • tcf-4
  • E2-2
  • ITF-2
  • ITF2
  • PTHS
  • SEF-2
  • SEF2
  • SEF2-1
  • SEF2-1A
  • SEF2-1B
  • TCF-4
  • bHLHb19
  • 5730422P05Rik
  • ASP-I2
  • E2.2
  • ITF-2b
  • ME2
  • MITF-2A
  • MITF-2B
  • TFE
  • Tcf-4
  • TCF4B
  • TCF4E
  • Tcf4
  • mTcf-4B
  • mTcf-4E
  • GE2
  • transcription factor 7-like 2 (T-cell specific, HMG-box)
  • transcription factor 4
  • transcription factor 7 like 2, T cell specific, HMG box
  • TCF7L2
  • tcf4
  • TCF4
  • Tcf4
  • Tcf7l2
  • LOC396347
Reactivity
Human
85
24
13
5
5
5
3
3
2
1
1
1
Host
Rabbit
55
19
11
Clonality
Polyclonal
Conjugate
This TCF4 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
80
42
23
20
13
12
8
4
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN4358095
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1875039 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3021530 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1585353 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2403952 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2888124 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1585796 IP IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2894047 IHC WB Rabbit Log in to see Polyclonal
1 ABIN2372671 IC IP IHC ELISA WB Mouse IgG2a AA 31-331 Log in to see 0-T-149
1 ABIN2701827 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN5542392 ELISA FACS ICC IHC WB Mouse IgG1 AA 518-667 Log in to see 4D4C4
1 ABIN5542393 ELISA FACS ICC IHC WB Mouse IgG2b AA 518-667 Log in to see 7B1B3
1 ABIN2989289 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3040026 IF/ICC IHC IP WB Rabbit Log in to see Polyclonal

Top referenced anti-TCF4 antibody for Immunohistochemistry

Similar anti-TCF4 Antibodies

Application / Reactivity Human
Chromatin Immunoprecipitation (ChIP) 1 Antibodies
Electrophoretic Mobility-Shift Assay (EMSA) 1 Antibodies
ELISA 42 Antibodies
Flow Cytometry (FACS) 23 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 20 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunohistochemistry (IHC) 14 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 12 Antibodies
Western Blotting (WB) 80 Antibodies

General

Antigen Transcription Factor 4 (TCF4) Antibodies
Reactivity Human
(85), (24), (13), (5), (5), (5), (3), (3), (2), (1), (1), (1)
Host Rabbit
(55), (19), (11)
Clonality
Polyclonal
Conjugate This TCF4 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(80), (42), (23), (20), (13), (12), (8), (4), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-TCF4 Antibody

Target Details TCF4 Application Details Handling References for anti-TCF4 Antibody (ABIN4358095) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
Isotype IgG

Target Details TCF4

Product Details anti-TCF4 Antibody Application Details Handling References for anti-TCF4 Antibody (ABIN4358095) Images back to top
Antigen
Alternative Name TCF4 (TCF4 Antibody Abstract)
Background Gene Symbol: TCF4
Gene ID 6925
UniProt P15884
Research Area Stem Cells, Transcription Factors, Wnt
Pathways WNT Signaling, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Regulation of Hormone Metabolic Process, Carbohydrate Homeostasis, Stem Cell Maintenance, Protein targeting to Nucleus

Application Details

Product Details anti-TCF4 Antibody Target Details TCF4 Handling References for anti-TCF4 Antibody (ABIN4358095) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TCF4 Antibody Target Details TCF4 Application Details References for anti-TCF4 Antibody (ABIN4358095) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-TCF4 Antibody (ABIN4358095)

Product Details anti-TCF4 Antibody Target Details TCF4 Application Details Handling Images back to top
Product cited in:

Saegusa, Hashimura, Kuwata: "Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 92, Issue 4, pp. 511-21, 2012