anti-Human CISD2 antibody for Western Blotting

Recommended CISD2 Antibody (supplied by: Log in to see )

Antigen
CDGSH Iron Sulfur Domain 2 (CISD2) Antibodies
  • ERIS
  • Miner1
  • NAF-1
  • WFS2
  • ZCD2
  • 1500009M05Rik
  • 1500026J14Rik
  • 1500031D15Rik
  • AI848398
  • B630006A20Rik
  • Noxp70
  • Zcd2
  • RGD1566242
  • zgc:64148
  • eris
  • miner1
  • wfs2
  • zcd2
  • cisd2
  • CDGSH iron sulfur domain 2
  • CDGSH iron sulfur domain 2 L homeolog
  • CDGSH iron sulfur domain 2 S homeolog
  • CISD2
  • Cisd2
  • cisd2
  • cisd2.L
  • cisd2.S
Epitope
N-Term
4
3
3
2
1
1
Reactivity
Human
35
18
16
2
2
2
2
2
1
1
1
Host
Rabbit
35
2
Clonality
Polyclonal
Conjugate
This CISD2 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
33
20
16
11
5
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN635156
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
16.557352 ABIN6138636 WB Rabbit Log in to see Polyclonal 0
16.557352 ABIN6138635 WB Rabbit Log in to see Polyclonal 0
12.754771 ABIN6390194 ELISA WB Rabbit IgG AA 31-80 Log in to see Polyclonal 0
12.754771 ABIN2137675 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
7.802582 ABIN6260844 IHC WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN2781919 WB Rabbit N-Term Log in to see Polyclonal 1
4.802582 ABIN1876438 IF IHC IP WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN2458860 ELISA WB Rabbit Log in to see Polyclonal 0
4.802582 ABIN5973017 WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN5575523 ELISA IF IHC WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN5965435 WB Rabbit IgG Log in to see Polyclonal 0
4.802582 ABIN5965436 WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN341293 WB Rabbit IgG N-Term Log in to see Polyclonal 0
4 ABIN1915925 ELISA IF IHC IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN5689926 ELISA IF IHC (p) WB Rabbit IgG AA 40-90 Log in to see Polyclonal 0
1 ABIN2860760 IF IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN5660851 WB Rabbit Log in to see Polyclonal 0
1 ABIN2882303 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2315133 IF IHC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN6291913 WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen CDGSH Iron Sulfur Domain 2 (CISD2) Antibodies
Epitope N-Term
(4), (3), (3), (2), (1), (1)
Reactivity Human
(35), (18), (16), (2), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(35), (2)
Clonality
Polyclonal
Conjugate This CISD2 antibody is un-conjugated
(1), (1), (1)
Application Western Blotting (WB)
(33), (20), (16), (11), (5), (3), (2), (1)
Supplier Log in to see

Product Details anti-CISD2 Antibody

Target Details CISD2 Application Details Handling Images
Specificity CISD2 antibody was raised against the N terminal of CISD2
Purification Affinity purified
Immunogen CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
Plasmids, Primers & others

Target Details CISD2

Product Details anti-CISD2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CISD2 (CISD2 Antibody Abstract)
Background CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Molecular Weight 15 kDa (MW of target protein)
Pathways Activation of Innate immune Response

Application Details

Product Details anti-CISD2 Antibody Target Details CISD2 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Restrictions For Research Use only

Handling

Product Details anti-CISD2 Antibody Target Details CISD2 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-CISD2 Antibody Target Details CISD2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-CDGSH Iron Sulfur Domain 2 (CISD2) (N-Term) antibody (ABIN635156) CISD2 antibody used at 1 ug/ml to detect target protein.