anti-Mouse (Murine) UGGT1 antibody for Immunohistochemistry

Recommended UGGT1 Antibody (supplied by: Log in to see )

Antigen
UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) Antibodies
  • UGCGL1
  • ugcgl1
  • uggt2
  • 0910001L17Rik
  • A930007H10Rik
  • AA589501
  • AI414429
  • AI448372
  • C820010P03Rik
  • GT
  • UGT1
  • Ugcgl1
  • Uggt
  • rUGT1
  • HUGT1
  • EMS-mutagenized bri1 suppressor 1
  • F3I17.13
  • F3I17_13
  • PRIORITY IN SWEET LIFE 2
  • PSL2
  • UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE
  • UGGT
  • UDP-glucose glycoprotein glucosyltransferase 1
  • UDP-glucose glycoprotein glucosyltransferase 1 L homeolog
  • UDP-glucose:glycoprotein glucosyltransferase 1
  • EMS-MUTAGENIZED BRI1 SUPPRESSOR 1
  • UGGT1
  • uggt1.L
  • uggt1
  • LOC100545947
  • Uggt1
  • EBS1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
35
8
7
1
1
Host
Rabbit
36
Clonality
Polyclonal
Conjugate
This UGGT1 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
23
18
6
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4364281
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4364282 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1875272 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1094388 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1094389 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN3059303 IP IHC WB Rabbit Log in to see Polyclonal 0

General

Antigen UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(35), (8), (7), (1), (1)
Host Rabbit
(36)
Clonality
Polyclonal
Conjugate This UGGT1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (23), (18), (6), (1), (1), (1)
Supplier Log in to see

Product Details anti-UGGT1 Antibody

Target Details UGGT1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Isotype IgG

Target Details UGGT1

Product Details anti-UGGT1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name UGGT1 (UGGT1 Antibody Abstract)
Background Gene Symbol: UGGT1
Gene ID 56886
Pathways Activation of Innate immune Response

Application Details

Product Details anti-UGGT1 Antibody Target Details UGGT1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-UGGT1 Antibody Target Details UGGT1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-UGGT1 Antibody Target Details UGGT1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Western Blot: UGGT1 Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibrobla...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Immunohistochemistry-Paraffin: UGGT1 Antibody - Staining of human epididymis shows s...