Parathyroid Hormone 2 (PTH2) antibody

Catalog No. ABIN109738

Product Details

Target: Parathyroid Hormone 2 (PTH2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: ELISA, Radioimmunoassay (RIA)

Specificity: Human, bovine, canis TIP 39

Immunogen: synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)

Application Details

Application Notes: ELISA (1/4.000) RIA (1/ 2.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details

Target: Parathyroid Hormone 2 (PTH2)

Alternative Name: TIP 39 (PTH2 Products)

Synonyms: TIP39 antibody, Tifp39 antibody, Tip39 antibody, RGD1559447 antibody, pth2 antibody, parathyroid hormone 2 antibody, parathyroid hormone 1b antibody, tuberoinfundibular 39 residue protein antibody, PTH2 antibody, Pth2 antibody, pth1b antibody, TIP39 antibody

Background: Serum

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development