AIFM1 antibody (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1) (AA 151-180)

Details for Product anti-AIFM1 Antibody No. ABIN1731624
Antigen
Epitope
AA 151-180
27
18
15
11
11
10
8
7
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
208
106
100
25
15
14
12
10
8
8
6
5
4
2
1
1
Host
Rabbit
192
18
3
2
Clonality
Polyclonal
Conjugate
This AIFM1 antibody is un-conjugated
8
5
5
4
4
4
4
4
4
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
177
83
69
42
42
28
15
15
13
9
9
5
3
1
1
Options
Immunogen Human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
Isotype IgG
Specificity Reacts with human AIFM1 / AIF
Cross-Reactivity Mouse (Murine), Rat (Rattus)
Cross-Reactivity (Details) Cross reacts with mouse and rat protein.
Purification Purified
Antigen
Alternative Name AIFM1 / AIF (AIFM1 Antibody Abstract)
UniProt O95831
Pathways Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration
Application Notes

Working dilution: IHC - P (5 μg/mL), WB

Restrictions For Research Use only
Format Liquid
Buffer TBS, 50 % glycerol, 0.5 mg/mL BSA, 0.02 % Sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C/-20 °C
Storage Comment Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
Supplier Images
Image no. 1 for anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1) (AA 151-180) antibody (ABIN1731624) anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1) (AA 151-180) antibody