IL21 Receptor antibody (AA 35-65)

Catalog No. ABIN1819422

Product Details anti-IL21 Receptor Antibody

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Binding Specificity: AA 35-65

Reactivity: Human, Monkey

Host: Goat

Clonality: Polyclonal

Conjugate: This IL21 Receptor antibody is un-conjugated

Application: ELISA, Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21. Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.

Purification: Affinity purified

Immunogen: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%), Chimpanzee, Gibbon (97%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Application Details

Application Notes: Approved: ELISA (1:50000), IHC, IHC-P (1:150)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C. Avoid freeze-thaw cycles.

Target Details for IL21 Receptor

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Alternative Name: IL21 Receptor / IL21R (IL21R Products)

Synonyms: IL21R antibody, il-21ra.a antibody, CD360 antibody, NILR antibody, interleukin 21 receptor antibody, interleukin 21 receptor, tandem duplicate 1 antibody, IL21R antibody, il21r.1 antibody, Il21r antibody

Background: Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor

Gene ID: 50615

UniProt: Q9HBE5

Pathways: JAK-STAT Signaling