AIFM1 antibody (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1) (AA 151-180)

Details for Product anti-AIFM1 Antibody No. ABIN2197878
Antigen
Epitope
AA 151-180
27
18
15
11
11
10
8
7
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
206
105
100
25
15
14
12
10
8
8
6
5
4
2
1
1
Host
Rabbit
190
18
3
2
Clonality
Polyclonal
Conjugate
This AIFM1 antibody is un-conjugated
8
5
5
4
4
4
4
4
4
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
175
83
66
43
41
28
15
14
13
9
9
4
3
1
1
Options
Immunogen Human AIF, aa151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA.
Sequence RARDPGARVL IVSEDPELPY MRPPLSKELW
Isotype IgG
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Cross-Reactivity (Details) Calculated cross reactivity: Hu Mo Rt
Characteristics AIFM1 (AIF, COXPD6, PDCD8, Programmed Cell death 8)
Purification Affinity Purified
Antigen
Alternative Name AIFM1 (AIFM1 Antibody Abstract)
Pathways Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only
Format Liquid
Buffer Supplied as a liquid in TBS, 0.5 mg/mL BSA, 0.02 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C