IL21 Receptor antibody (Interleukin 21 Receptor) (AA 35-65)

Details for Product anti-IL21R Antibody No. ABIN2474983
Antigen
  • IL21R
  • il-21ra.a
  • CD360
  • NILR
  • interleukin 21 receptor
  • interleukin 21 receptor, tandem duplicate 1
  • IL21R
  • il21r.1
  • Il21r
Epitope
AA 35-65, N-Term
15
10
9
8
7
4
3
3
2
2
2
1
1
1
1
Reactivity
Human
86
43
32
2
2
Host
Goat
87
4
4
3
Clonality
Polyclonal
Conjugate
This IL21 Receptor antibody is un-conjugated
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA
58
38
26
13
10
6
4
2
1
1
1
1
Options
Immunogen Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
Isotype IgG
Characteristics Purified IgG
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others IL21 Receptor products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name IL-21 RECEPTOR (IL21R Antibody Abstract)
Gene ID 50615
UniProt Q9HBE5
Pathways JAK-STAT Signaling
Application Notes Optimal working dilution should be determined by the investigator.
Restrictions For Research Use only
Format Liquid
Concentration 1.0 mg/mL
Supplier Images
Image no. 1 for anti-Interleukin 21 Receptor (IL21R) (AA 35-65), (N-Term) antibody (ABIN2474983) anti-Interleukin 21 Receptor (IL21R) (AA 35-65), (N-Term) antibody
Did you look for something else?