TSG101 antibody (C-Term)

Catalog No. ABIN3042318

Product Details anti-TSG101 Antibody

Target: TSG101 (Tumor Susceptibility Gene 101 (TSG101))

Binding Specificity: AA 361-390, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSG101 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.

Sequence: KHVRLLSRKQ FQLRALMQKA RKTAGLSDLY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.
Gene Name: tumor susceptibility 101
Protein Name: Tumor susceptibility gene 101 protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TSG101

Target: TSG101 (Tumor Susceptibility Gene 101 (TSG101))

Alternative Name: TSG101 (TSG101 Products)

Synonyms: CG9712 antibody, DmTSG101 antibody, Dmel\\CG9712 antibody, ESCRT-I antibody, Tsg101 antibody, burs antibody, dTSg101 antibody, dTsg101 antibody, dVps23 antibody, ept antibody, tsg101 antibody, vps23 antibody, TSG101 antibody, MGC76193 antibody, TSG10 antibody, VPS23 antibody, AI255943 antibody, CC2 antibody, Rw antibody, zgc:86926 antibody, tumor susceptibility 101 antibody, Tumor susceptibility gene 101 antibody, Tumor Susceptibility Gene homolog antibody, tumor susceptibility gene 101 antibody, tumor susceptibility 101a antibody, tumor susceptibility 101 L homeolog antibody, TSG101 antibody, tsg-101 antibody, tsg101 antibody, Tsg101 antibody, tsg101a antibody, tsg101.L antibody

Background: TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.

Synonyms: ESCRT I complex subunit TSG101 antibody|ESCRT-I complex subunit TSG101 antibody|TS101_HUMAN antibody|TSG 10 antibody|TSG 101 antibody||TSG10 antibody|Tsg101 antibody|Tumor susceptibility gene 10 antibody|Tumor susceptibility gene 101 antibody|Tumor susceptibility gene 101 protein antibody|Tumor susceptibility protein antibody|Tumor susceptibility protein isoform 3 antibody|VPS 23 antibody|VPS23 antibody

Gene ID: 7251

UniProt: Q99816