F2RL1 antibody (C-Term)
-
- Target See all F2RL1 Antibodies
- F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))
-
Binding Specificity
- AA 349-383, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This F2RL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.
- Sequence
- HDFRDHAKNA LLCRSVRTVK QMQVSLTSKK HSRKS
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.
Gene Name: coagulation factor II (thrombin) receptor-like 1
Protein Name: Proteinase-activated receptor 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product F2RL1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Effect and mechanism of PAR-2 on the proliferation of esophageal cancer cells." in: European review for medical and pharmacological sciences, Vol. 20, Issue 22, pp. 4688-4696, (2017) (PubMed).
: "
-
Effect and mechanism of PAR-2 on the proliferation of esophageal cancer cells." in: European review for medical and pharmacological sciences, Vol. 20, Issue 22, pp. 4688-4696, (2017) (PubMed).
-
- Target
- F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))
- Alternative Name
- F2RL1 (F2RL1 Products)
- Background
-
Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
Synonyms: Coagulation factor II receptor like 1 antibody|Coagulation factor II receptor-like 1 antibody|Coagulation factor II thrombin receptor like 1 antibody|F2RL1 antibody|G protein coupled receptor 11 antibody|G-protein coupled receptor 11 antibody|GPR11 antibody|PAR 2 antibody|PAR-2 antibody|PAR2_HUMAN antibody|Protease activated receptor 2 antibody| Proteinase activated receptor 2 antibody| Proteinase-activated receptor 2 antibody|Thrombin receptor like 1 antibody|Thrombin receptor-like 1 antibody - Gene ID
- 2150
- UniProt
- P55085
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interactome
-