Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Fascin antibody (N-Term)

FSCN1 Reactivity: Human, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3042407
  • Target See all Fascin (FSCN1) Antibodies
    Fascin (FSCN1)
    Binding Specificity
    • 16
    • 15
    • 5
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 42-73, N-Term
    Reactivity
    • 90
    • 52
    • 30
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Rat
    Host
    • 76
    • 36
    • 1
    • 1
    Rabbit
    Clonality
    • 67
    • 47
    Polyclonal
    Conjugate
    • 47
    • 13
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    This Fascin antibody is un-conjugated
    Application
    • 80
    • 47
    • 38
    • 32
    • 28
    • 28
    • 20
    • 14
    • 11
    • 7
    • 6
    • 3
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
    Sequence
    KKQIWTLEQP PDEAGSAAVC LRSHLGRYLA AD
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human,Rat.
    Gene Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
    Protein Name: Fascin
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product FSCN1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jiang, Wang, Chen: "Overexpression of FOXM1 is associated with metastases of nasopharyngeal carcinoma." in: Upsala journal of medical sciences, Vol. 119, Issue 4, pp. 324-32, (2014) (PubMed).

  • Target
    Fascin (FSCN1)
    Alternative Name
    FSCN1 (FSCN1 Products)
    Synonyms
    CG15331 antibody, CG1536 antibody, CG32858 antibody, Dmel\\CG32858 antibody, SN antibody, Sn antibody, fs(1)A1057 antibody, fs(1)K1421 antibody, fs(1)K418 antibody, fs(1)K473 antibody, fs(1)K743 antibody, fs(1)M45 antibody, p55 antibody, snl antibody, MGC75811 antibody, fscn1 antibody, sb:cb589 antibody, zgc:153632 antibody, AI663989 antibody, Fan1 antibody, fascin-1 antibody, Fascin antibody, fscn antibody, FAN1 antibody, HSN antibody, SNL antibody, fascin antibody, singed antibody, fascin actin-bundling protein 1 antibody, fascin actin-bundling protein 1a antibody, fascin actin-bundling protein 1 L homeolog antibody, sn antibody, fscn1 antibody, fscn1a antibody, Fscn1 antibody, fscn1.L antibody, FSCN1 antibody
    Background
    Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

    Synonyms: 55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody| Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody|Strongylocentrotus purpuratus antibody
    Gene ID
    6624
    UniProt
    Q16658
You are here:
Support