Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Haptoglobin antibody (HP) (AA 128-160) Primary Antibody

HP Reactivity: Human, Mouse IHC (p), WB Host: Rabbit Polyclonal unconjugated
Pubmed (1)
Catalog No. ABIN3042456
$280.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 4 to 6 Business Days
  • Target
    Haptoglobin (HP)
    Binding Specificity
    • 18
    • 10
    • 9
    • 8
    • 8
    • 7
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 128-160, Middle Region
    Reactivity
    • 137
    • 45
    • 41
    • 17
    • 11
    • 10
    • 8
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human, Mouse
    Host
    • 132
    • 23
    • 17
    • 9
    • 7
    • 3
    Rabbit
    Clonality
    • 167
    • 22
    Polyclonal
    Conjugate
    • 102
    • 30
    • 13
    • 10
    • 6
    • 6
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This Haptoglobin antibody is un-conjugated
    Application
    • 125
    • 82
    • 59
    • 27
    • 23
    • 22
    • 16
    • 15
    • 13
    • 11
    • 10
    • 9
    • 6
    • 6
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Haptoglobin(HP) detection. Tested with WB, IHC-P in Human,Mouse.
    Sequence
    NNEKQWINKA VGDKLPECEA VCGKPKNPAN PVQ
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Haptoglobin(HP) detection. Tested with WB, IHC-P in Human,Mouse.
    Gene Name: haptoglobin
    Protein Name: Haptoglobin
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
    Isotype
    IgG
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for Haptoglobin is approximately 0.2 ng/lane under reducing conditions.
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Cao, Chen, Gao, Hu, Liang, Xiao: "Identification of a protein associated with the activity of cytokine-induced killer cells." in: Oncology letters, Vol. 14, Issue 6, pp. 6937-6942, 2017 (PubMed).

  • Target
    Haptoglobin (HP)
    Alternative Name
    HP (HP Antibody Abstract)
    Synonyms
    HP, wu:fb64e01, BP, HP2ALPHA2, HPA1S, HP-1, HPR, Zonulin, haptoglobin, haptoglobin-like, HP, hp, Hp, LOC479668, LOC101102413
    Background
    Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.

    Synonyms: Binding peptide antibody|Bp antibody|Haptoglobin alpha chain antibody|Haptoglobin alpha(1S) beta antibody|Haptoglobin alpha(2FS) beta antibody|Haptoglobin beta chain antibody|Haptoglobin, alpha polypeptide antibody|Haptoglobin, beta polypeptide antibody|HP antibody|Hp2 alpha antibody|HP2 ALPHA2 antibody|HP2ALPHA2 antibody|HPA1S antibody|HPT antibody|HPT_HUMAN antibody|MGC111141 antibody|Zonulin antibody
    Gene ID
    3240
    UniProt
    P00738
    Pathways
    Transition Metal Ion Homeostasis
You are here:
help Support