TGFBR2 antibody (N-Term)

Catalog No. ABIN3043311

Product Details anti-TGFBR2 Antibody

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Binding Specificity: AA 96-128, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGFBR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.

Sequence: TLETVCHDPK LPYHDFILED AASPKCIMKE KKK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.
Gene Name: transforming growth factor, beta receptor II (70/80 kDa)
Protein Name: TGF-beta receptor type-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-TGFBR2 antibody (ABIN3043311)

Sha, Zhao, Tong, Gregersen, Zhao: "Mechanism Investigation of the Improvement of Chang Run Tong on the Colonic Remodeling in Streptozotocin-Induced Diabetic Rats." in: Journal of diabetes research, Vol. 2016, pp. 1826281, (2016) (PubMed).

Xu, Xu, Saud, Lu, Liu, Fang, Zhang, Hu, Li: "Effect of Kuijie Granule on the Expression of TGF-β/Smads Signaling Pathway in Patients with Ulcerative Colitis." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2016, pp. 2601830, (2016) (PubMed).

Target Details for TGFBR2

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Alternative Name: TGFBR2 (TGFBR2 Products)

Synonyms: AAT3 antibody, FAA3 antibody, LDS1B antibody, LDS2B antibody, MFS2 antibody, RIIC antibody, TAAD2 antibody, TGFR-2 antibody, TGFbeta-RII antibody, 1110020H15Rik antibody, AU042018 antibody, DNIIR antibody, RIIDN antibody, TBR-II antibody, TbetaR-II antibody, TbetaRII antibody, TGFBR2 antibody, TBETA-RII antibody, TGFBRII antibody, TGF-beta 2 antibody, Tgfbr2T antibody, cb537 antibody, tgfbr2 antibody, wu:fj05c10 antibody, zgc:110498 antibody, transforming growth factor beta receptor 2 antibody, transforming growth factor, beta receptor II antibody, transforming growth factor, beta receptor 2 antibody, transforming growth factor beta receptor 2b antibody, TGFBR2 antibody, Tgfbr2 antibody, tgfbr2b antibody

Background: TGFBR2 (transforming growth factor, beta receptor II (70/80 kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.

Synonyms: AAT 3 antibody|AAT3 antibody|FAA 3 antibody|FAA3 antibody|HNPCC6 antibody|LDS1B antibody|LDS2B antibody|MFS 2 antibody|MFS2 antibody| RIIC antibody|TAAD 2 antibody|TAAD2 antibody|TbetaR II antibody|TbetaR-II antibody|TGF beta receptor type 2 antibody|TGF beta receptor type II antibody|TGF beta receptor type IIB antibody|TGF beta type II receptor antibody|TGF-beta receptor type II antibody|TGF-beta receptor type-2 antibody|TGF-beta type II receptor antibody|TGFB R2 antibody|TGFbeta RII antibody|TGFBR 2 antibody|TGFBR2 antibody| TGFR 2 antibody|TGFR-2 antibody|TGFR2 antibody|TGFR2_HUMAN antibody|Transforming growth factor beta receptor II antibody|Transforming growth factor beta receptor type II antibody|Transforming growth factor beta receptor type IIC antibody|Transforming growth factor-beta receptor type II antibody

Gene ID: 7048

UniProt: P37173