SECTM1 antibody (C-Term)

Catalog No. ABIN3043325

Product Details anti-SECTM1 Antibody

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Binding Specificity: AA 118-152, C-Term

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SECTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.

Sequence: KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.
Gene Name: secreted and transmembrane 1B
Protein Name: Secreted and transmembrane protein 1b

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Alternative Name: SECTM1 (SECTM1 Products)

Synonyms: K12 antibody, secreted and transmembrane 1 antibody, SECTM1 antibody

Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Synonyms: K12 antibody|K12 protein antibody|Protein K-12 antibody|Protein K12 antibody|SCTM1_HUMAN antibody|Secreted and transmembrane 1 antibody|Secreted and transmembrane protein 1 antibody|SECTM 1 antibody|SECTM1 antibody|Type 1a transmembrane protein antibody

Gene ID: 58210