Osteopontin antibody (C-Term)

Catalog No. ABIN3043353

Product Details anti-Osteopontin Antibody

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Binding Specificity: AA 281-314, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Osteopontin antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purpose: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human,Mouse,Rat.

Sequence: HEDMLVVDPK SKEEDKHLKF RISHELDSAS SEVN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human,Mouse,Rat.
Gene Name: secreted phosphoprotein 1
Protein Name: Osteopontin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Osteopontin antibody (ABIN3043353)

Hou, Huang, Luo, Wang, Liu, Deng, Zhang, Liu, Chen: "MiR-351 negatively regulates osteoblast differentiation of MSCs induced by (+)-cholesten-3-one through targeting VDR." in: American journal of translational research, Vol. 9, Issue 11, pp. 4963-4973, (2017) (PubMed).

Qu, Hui, Wang, Tang, Zhong, Liu, Li, Feng, He et al.: "Reduced Expression of the Extracellular Calcium-Sensing Receptor (CaSR) Is Associated with Activation of the Renin-Angiotensin System (RAS) to Promote Vascular Remodeling in the Pathogenesis of ..." in: PLoS ONE, Vol. 11, Issue 7, pp. e0157456, (2016) (PubMed).

Yin, Cheng, Qin, Yu, Yu, Zhong, Sun, Zhang: "Effects of Naringin on Proliferation and Osteogenic Differentiation of Human Periodontal Ligament Stem Cells In Vitro and In Vivo." in: Stem cells international, Vol. 2015, pp. 758706, (2015) (PubMed).

Shan, Zhou, He, Feng, Chen, Zhong: "Expression of both matrix metalloproteinase-2 and its tissue inhibitor-2 in tunica media of radial artery in uremic patients." in: Renal failure, Vol. 35, Issue 1, pp. 37-42, (2013) (PubMed).

Target Details for Osteopontin

Target: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Alternative Name: SPP1 (SPP1 Products)

Synonyms: BNSP antibody, BSPI antibody, ETA-1 antibody, OPN antibody, 2AR antibody, Apl-1 antibody, Bsp antibody, Eta antibody, OP antibody, Opn antibody, Opnl antibody, Ric antibody, Spp-1 antibody, OSP antibody, zgc:111821 antibody, secreted phosphoprotein 1 antibody, SPP1 antibody, Spp1 antibody, spp1 antibody

Background: Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.

Synonyms: BNSP antibody|Bone sialoprotein 1 antibody|BSP I antibody|BSPI antibody|Early T lymphocyte activation 1 antibody|ETA 1 antibody|ETA1 antibody|MGC110940 antibody|Nephropontin antibody|OPN antibody|Osteopontin antibody|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody|OSTP_HUMAN antibody|PSEC0156 antibody|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody|Secreted phosphoprotein 1 antibody|SPP 1 antibody|SPP-1 antibody|SPP1 antibody| SPP1/CALPHA1 fusion antibody|Urinary stone protein antibody|Uropontin antibody

Gene ID: 6696

UniProt: P10451

Pathways: Regulation of Cell Size