TRPV5 antibody (C-Term)
-
- Target See all TRPV5 Antibodies
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
-
Binding Specificity
- AA 580-610, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPV5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
- Sequence
- DTHWRVAQER DELWRAQVVA TTVMLERKLP R
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Transient receptor potential cation channel subfamily V member 5(TRPV5) detection. Tested with WB in Human,Rat.
Gene Name: transient receptor potential cation channel, subfamily V, member 5
Protein Name: Transient receptor potential cation channel subfamily V member 5 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product TRPV5 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))
- Alternative Name
- TRPV5 (TRPV5 Products)
- Synonyms
- CaT2 antibody, Ecac1 antibody, CAT2 antibody, ECAC1 antibody, OTRPC3 antibody, D630033B11 antibody, TRPV5 antibody, ECAC antibody, cat2 antibody, xcat2 antibody, transient receptor potential cation channel, subfamily V, member 5 antibody, transient receptor potential cation channel subfamily V member 5 antibody, calcium transporter 2 L homeolog antibody, Trpv5 antibody, TRPV5 antibody, LOC100011049 antibody, trpv5 antibody, cat2.L antibody
- Background
-
Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+. Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
Synonyms: Calcium transport protein 2 antibody|Calcium transporter 2 antibody|CAT 2 antibody|CAT2 antibody|ECAC 1 antibody|ECaC antibody|ECAC1 antibody|Epithelial calcium channel 1 antibody|Osm 9 like TRP channel 3 antibody|Osm-9-like TRP channel 3 antibody|OTRPC 3 antibody|OTRPC3 antibody|Transient receptor potential cation channel subfamily V member 5 antibody|TRPV 5 antibody|TrpV5 antibody|TRPV5_HUMAN antibody - Gene ID
- 56302
-