APH1A antibody (C-Term)

Catalog No. ABIN3043504

Product Details anti-APH1A Antibody

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Binding Specificity: AA 236-265, C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APH1A antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1A(APH1A) detection. Tested with WB in Human,Mouse.

Sequence: LRSIQRSLLC RRQEDSRVMV YSALRIPPED

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1A(APH1A) detection. Tested with WB in Human,Mouse.
Gene Name: APH1A gamma secretase subunit
Protein Name: Gamma-secretase subunit APH-1A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for APH1a is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for APH1A

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Alternative Name: APH1A (APH1A Products)

Synonyms: 6530402N02Rik antibody, APH-1 antibody, APH-1A antibody, CGI-78 antibody, RGD1311546 antibody, APH-1a antibody, aph-1 homolog A, gamma-secretase subunit antibody, aph-1 homolog A, gamma secretase subunit L homeolog antibody, aph-1 homolog A, gamma secretase subunit antibody, anterior pharynx defective 1 homolog A (C. elegans) antibody, aph1 homolog A, gamma secretase subunit antibody, acylamino-acid-releasing enzyme-like antibody, APH1A antibody, aph1a.L antibody, Aph1a antibody, LOC100219182 antibody

Background: APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

Synonyms: 6530402N02Rik antibody|AL138795.3 antibody|Anterior Pharynx Defective 1 antibody|Anterior pharynx defective 1 homolog A antibody|APH 1A antibody|Aph 1alpha antibody|APH-1a antibody| Aph-1alpha antibody|Aph1a antibody|APH1A gamma secretase subunit antibody|APH1A_HUMAN antibody|CGI 78 antibody|CGI78 antibody|Gamma secretase subunit APH 1A antibody|Gamma Secretase Subunit APH1a antibody|Gamma-secretase subunit APH-1A antibody|Likely ortholog of C. elegans anterior pharynx defective 1A antibody|Presenilin Stabilization Factor antibody| Presenilin-stabilization factor antibody|PSF antibody|UNQ579/PRO1141 antibody

Gene ID: 51107

Pathways: Notch Signaling, Neurotrophin Signaling Pathway