RBX1 antibody (C-Term)

Catalog No. ABIN3043566

Product Details anti-RBX1 Antibody

Target: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Binding Specificity: AA 76-108, C-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBX1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: NHAFHFHCIS RWLKTRQVCP LDNREWEFQK YGH

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ring-box 1, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase RBX1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ROC1 (76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RBX1

Target: RBX1 (Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1))

Alternative Name: RBX1 (RBX1 Products)

Synonyms: BA554C12.1 antibody, RNF75 antibody, ROC1 antibody, 1500002P15Rik antibody, AA517855 antibody, im:7137515 antibody, zgc:136444 antibody, RBX1 antibody, ATRBX1 antibody, F7C8.160 antibody, F7C8_160 antibody, HRT1 antibody, REGULATOR OF CULLINS-1 antibody, RING-BOX 1 antibody, RING-box 1 antibody, hop21 antibody, BEST:CK01110 antibody, CG16982 antibody, CK01110 antibody, Dmel\CG16982 antibody, EG:115C2.11 antibody, Rbx1 antibody, Rbx1/Roc antibody, Roc antibody, Roc1alpha antibody, anon-EST:Posey65 antibody, dRbx1 antibody, dRoc1 antibody, dRoc1a antibody, ring-box 1 antibody, ring-box 1, E3 ubiquitin protein ligase antibody, RING-box 1 antibody, RING-box protein 1 antibody, RING-box protein 1a antibody, Regulator of cullins 1a antibody, RBX1 antibody, Rbx1 antibody, rbx1 antibody, MGG_08844 antibody, LOC9308017 antibody, rbx-1 antibody, Roc1a antibody

Background: RING-box protein 1, also known as ROC1, is a protein that in humans is encoded by the RBX1 gene. This gene is mapped to chromosome 22q13.2 based on an alignment of the RBX1 sequence with the genomic sequence. ROC1 is recruited by cullin-1 to form a quaternary SCF (HOS)-ROC1 holoenzyme (with SKP1 and the BTRCP homolog HOS). SCF (HOS)-ROC1 binds IKK-beta-phosphorylated I-kappa-B-alpha and catalyzes its ubiquitination in the presence of ubiquitin, E1, and CDC34. Conclusively, ROC1 plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization.

Synonyms: BA554C12.1 antibody|E3 ubiquitin-protein ligase RBX1 antibody|FLJ60363 antibody|MGC13357 antibody|MGC1481 antibody|OTTHUMP00000028983 antibody|Protein ZYP antibody|Rbx 1 antibody|Rbx1 antibody|RBX1_HUMAN antibody|Regulator of cullins 1 antibody|Ring box 1 antibody| Ring box 1 E3 ubiquitin protein ligase antibody|RING box protein 1 antibody|RING finger protein 75 antibody|RING finger protein antibody|RING-box protein 1 antibody|Ringbox protein 1 antibody|RNF 75 antibody|RNF75 antibody|ROC 1 antibody|ZYP protein antibody

Gene ID: 9978

UniProt: P62877

Pathways: Cell Division Cycle, M Phase, SARS-CoV-2 Protein Interactome