NR3C2 antibody (C-Term)
-
- Target See all NR3C2 Antibodies
- NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))
-
Binding Specificity
- AA 950-984, C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR3C2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- HALKVEFPAM LVEIISDQLP KVESGNAKPL YFHRK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: nuclear receptor subfamily 3, group C, member 2
Protein Name: Mineralocorticoid receptor - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product NR3C2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells." in: Oncotarget, Vol. 7, Issue 1, pp. 94-111, (2016) (PubMed).
: "
-
GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells." in: Oncotarget, Vol. 7, Issue 1, pp. 94-111, (2016) (PubMed).
-
- Target
- NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))
- Alternative Name
- NR3C2 (NR3C2 Products)
- Synonyms
- mr antibody, si:ch211-189l17.1 antibody, LOC100302443 antibody, NR3C2 antibody, LOC443144 antibody, MLR antibody, MR antibody, MCR antibody, NR3C2VIT antibody, Mlr antibody, mlr antibody, nuclear receptor subfamily 3, group C, member 2 antibody, nuclear receptor subfamily 3 group C member 2 antibody, mineralocorticoid receptor antibody, nuclear receptor subfamily 3 group C member 2 L homeolog antibody, nr3c2 antibody, NR3C2 antibody, LOC443144 antibody, Nr3c2 antibody, nr3c2.L antibody
- Background
-
NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
Synonyms: Aldosterone receptor antibody|MCR antibody|MCR_HUMAN antibody|MGC133092 antibody| Mineralocorticoid receptor antibody|MLR antibody|MR antibody|NR3 C2 antibody|NR3C2 antibody|NR3C2 protein antibody|Nuclear receptor subfamily 3 group C member 2 antibody - Gene ID
- 4306
- UniProt
- P08235
- Pathways
- ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-