FABP4 antibody (N-Term)

Catalog No. ABIN3043827

Product Details anti-FABP4 Antibody

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Binding Specificity: AA 10-40, N-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KLVSSENFDD YMKEVGVGFA TRKVAGMAKP N

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 4, adipocyte
Protein Name: Fatty acid-binding protein, adipocyte

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FABP4

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Alternative Name: FABP4 (FABP4 Products)

Synonyms: A-FABP antibody, AFABP antibody, ALBP antibody, aP2 antibody, LOC100223994 antibody, FABP antibody, AP2 antibody, FABP3 antibody, FABP4 antibody, MGC84940 antibody, fabp4 antibody, 422/aP2 antibody, ALBP/Ap2 antibody, Ap2 antibody, Lbpl antibody, Albp antibody, fatty acid binding protein 4 antibody, fatty acid-binding protein, adipocyte antibody, fatty acid binding protein 4, adipocyte antibody, fatty acid binding protein 4, adipocyte L homeolog antibody, Fatty acid-binding protein, adipocyte antibody, adipocyte fatty acid-binding protein antibody, adipocyte fatty acid binding protein antibody, FABP4 antibody, LOC100223994 antibody, fabp4.L antibody, fabp4 antibody, Fabp4 antibody, LOC100732353 antibody, LOC100861279 antibody, LOC100057425 antibody, LOC395224 antibody

Background: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

Synonyms: 3T3-L1 lipid-binding protein antibody|422/aP2 antibody|A FABP antibody|A-FABP antibody|adipocyte antibody|Adipocyte lipid binding protein antibody|Adipocyte lipid-binding protein antibody|Adipocyte protein AP2 antibody|Adipocyte-type fatty acid-binding protein antibody|AFABP antibody|ALBP antibody|ALBP/Ap2 antibody|aP2 antibody|FABP antibody|FABP4 antibody|FABP4_HUMAN antibody|Fatty acid binding protein 4 adipocyte antibody|Fatty acid binding protein 4 antibody|Fatty acid binding protein adipocyte antibody|Fatty acid-binding protein 4 antibody|Fatty acid-binding protein antibody|Lbpl antibody|Myelin P2 protein homolog antibody|P15 antibody|P2 adipocyte protein antibody|Protein 422 antibody

Gene ID: 2167

UniProt: P15090

Pathways: Brown Fat Cell Differentiation