HSP90AA1 antibody (C-Term)

Catalog No. ABIN3043848

Product Details anti-HSP90AA1 Antibody

Target: HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))

Binding Specificity: AA 454-488, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP90AA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QNRKKLSELL RYYTSASGDE MVSLKDYCTR MKEN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock protein 90 kDa alpha (cytosolic), class A member 1
Protein Name: Heat shock protein HSP 90-alpha

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-HSP90AA1 antibody (ABIN3043848)

Cheng, Zhao, Wang, Lu, Wang, Wang, Yao: "The effect of 5'-adenylic acid on hepatic proteome of mice radiated by 60Co γ-ray." in: International journal of molecular sciences, Vol. 15, Issue 1, pp. 186-202, (2014) (PubMed).

Jiang, Wang, Li, Shi, Li, Ma, Li, Luo, Yang, Xu: "Heat shock protein 90-mediated inactivation of nuclear factor-?B switches autophagy to apoptosis through becn1 transcriptional inhibition in selenite-induced NB4 cells." in: Molecular biology of the cell, Vol. 22, Issue 8, pp. 1167-80, (2011) (PubMed).

Target Details for HSP90AA1

Target: HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))

Alternative Name: HSP90AA1 (HSP90AA1 Products)

Synonyms: EL52 antibody, HSP86 antibody, HSP89A antibody, HSP90A antibody, HSP90N antibody, HSPC1 antibody, HSPCA antibody, HSPCAL1 antibody, HSPCAL4 antibody, HSPN antibody, Hsp89 antibody, Hsp90 antibody, LAP2 antibody, Hsp86 antibody, Hspca antibody, htpG antibody, 86kDa antibody, 89kDa antibody, AL024080 antibody, AL024147 antibody, Hsp86-1 antibody, hsp4 antibody, HSP90 antibody, HSP90AA1 antibody, fb17b01 antibody, hsp90 antibody, hsp90a antibody, hsp90a.1 antibody, hsp90alpha antibody, wu:fb17b01 antibody, zgc:86652 antibody, Hsp90alpha antibody, heat shock protein 90 alpha family class A member 1 antibody, heat shock protein 90, alpha (cytosolic), class A member 1 antibody, Heat Shock Protein 90, cytosolic antibody, heat shock protein 90A antibody, molecular chaperone antibody, heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 antibody, heat shock protein HSP 90-alpha antibody, heat shock protein 90kDa alpha (cytosolic), class A member 1 antibody, HSP90AA1 antibody, Hsp90aa1 antibody, HSP90A antibody, hsp90A antibody, hsp90aa1.1 antibody, LOC108698781 antibody

Background: Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90- kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85 % amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

Synonyms: EL52 antibody|epididymis luminal secretory protein 52 antibody|Heat shock 86 kDa antibody|heat shock 90kD protein 1, alpha antibody| Heat shock 90kD protein 1, alpha like 4 antibody|heat shock 90kD protein, alpha-like 4 antibody|Heat shock 90 kDa protein 1 alpha antibody|Heat shock protein 90 kDa alpha (cytosolic) class A member 1 antibody|heat shock protein 90 kDa alpha (cytosolic), class A member 2 antibody|Heat shock protein HSP 90-alpha antibody|HS90A_HUMAN antibody|HSP 86 antibody|HSP 86 antibody|HSP86 antibody|Hsp89 antibody|HSP89A antibody|Hsp90 antibody|HSP90A antibody|HSP90AA1 antibody|HSP90ALPHA antibody|HSP90N antibody|HSPC1 antibody|HSPCA antibody|HSPCAL1 antibody|HSPCAL3 antibody|HSPCAL4 antibody|HSPN antibody|LAP 2 antibody|LAP2 antibody|lipopolysaccharide-associated protein 2 antibody|LPS-associated protein 2 antibody|Renal carcinoma antigen NY REN 38 antibody|Renal carcinoma antigen NY-REN-38 antibody

Gene ID: 3320

UniProt: P07900

Pathways: M Phase, Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals