RENT1/UPF1 antibody (Middle Region)
-
- Target See all RENT1/UPF1 (UPF1) Antibodies
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
-
Binding Specificity
- AA 578-614, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RENT1/UPF1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- NMDSMPELQK LQQLKDETGE LSSADEKRYR ALKRT
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: UPF1 regulator of nonsense transcripts homolog (yeast)
Protein Name: Regulator of nonsense transcripts 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product UPF1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
- Alternative Name
- UPF1 (UPF1 Products)
- Synonyms
- HUPF1 antibody, NORF1 antibody, RENT1 antibody, pNORF1 antibody, smg-2 antibody, B430202H16Rik antibody, PNORF-1 antibody, Rent1 antibody, Upflp antibody, rent1 antibody, wu:fi40f07 antibody, wu:fj48a01 antibody, zgc:55472 antibody, Tb05.3C6.50 antibody, AO090012000584 antibody, hupf1 antibody, norf1 antibody, pnorf1 antibody, upf1 antibody, UPF1, RNA helicase and ATPase antibody, UPF1 regulator of nonsense transcripts homolog (yeast) antibody, upf1 regulator of nonsense transcripts homolog (yeast) antibody, regulator of nonsense transcripts 1 antibody, Regulator of nonsense transcripts 1 antibody, UPF1 regulator of nonsense transcripts homolog S homeolog antibody, UPF1 antibody, Upf1 antibody, upf1 antibody, Tc00.1047053511317.30 antibody, Tb927.5.2140 antibody, TVAG_453890 antibody, TVAG_237840 antibody, AOR_1_1018194 antibody, HPB8_739 antibody, smg-2 antibody, upf1.S antibody
- Background
-
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
Synonyms: ATP dependent helicase RENT1 antibody|ATP-dependent helicase RENT1 antibody|Delta helicase antibody|FLJ43809 antibody|FLJ46894 antibody|HUPF 1 antibody|hUpf1 antibody|KIAA0221 antibody|Nonsense mRNA reducing factor 1 antibody|NORF 1 antibody|NORF1 antibody| pNORF 1 antibody|pNORF1 antibody|Regulator of nonsense transcripts 1 antibody|RENT 1 antibody|RENT1 antibody|RENT1_HUMAN antibody|Smg 2 antibody|Smg 2 homolog nonsense mediated mRNA decay factor antibody|UP Frameshift 1 antibody|Up frameshift mutation 1 homolog (S. cerevisiae) antibody|Up frameshift mutation 1 homolog antibody|Up frameshift suppressor 1 homolog antibody|Up-frameshift suppressor 1 homolog antibody|UPF 1 antibody|UPF 1 regulator of nonsense transcripts homolog antibody|upf1 antibody|UPF1 regulator of nonsense transcripts homolog antibody|Yeast Upf1p homolog antibody - Gene ID
- 5976
- UniProt
- Q92900
- Pathways
- SARS-CoV-2 Protein Interactome
-