Exendin 4 antibody

Details for Product No. ABIN3170488
Antigen
Reactivity
15
8
6
5
Host
Rabbit
27
9
Clonality
Polyclonal
Conjugate
Un-conjugated
7
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Enzyme Immunoassay (EIA), Immunoprecipitation (IP)
18
13
3
3
2
2
2
Options
Purpose Rabbit polyclonal antibody raised against synthetic peptide of exendin-4.
Immunogen

immunogen: A synthetic peptide (conjugated with KLH) corresponding to exendin-4.

Immunogen Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Isotype IgG
Antigen
Alternative Name Exendin-4
Application Notes The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Buffer In PBS, pH 7.4 (50 % glycerol, 0.02 % sodium azide)
Storage -20 °C
Storage Comment Store at -20°C.
Aliquot to avoid repeated freezing and thawing.