ARPC1B antibody (Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa)

Details for Product anti-ARPC1B Antibody No. ABIN4278119, Supplier: Log in to see
Antigen
  • ARC41
  • p40-ARC
  • p41-ARC
  • ARP2
  • cb871
  • arpc1a
  • fj15h02
  • zgc:64056
  • wu:fj08e12
  • wu:fj15h02
  • 41kDa
  • AA408064
  • AA408534
  • AA571392
  • AF007010
  • AW208418
  • L72
  • SOP2Hs
  • ACTIN-RELATED PROTEIN C1
  • ARPC1
  • F16D14.14
  • F16D14_14
  • actin-related protein C1B
  • arc41
  • p40-arc
  • p41-arc
  • actin related protein 2/3 complex subunit 1B
  • ARP2 actin related protein 2 homolog
  • actin related protein 2/3 complex, subunit 1B
  • ARP2/3 complex 41 kDa subunit
  • actin-related protein C1B
  • actin-related protein 2/3 complex subunit 1B
  • actin related protein 2/3 complex subunit 1B S homeolog
  • ARPC1B
  • ACTR2
  • Arpc1b
  • EHI_094120
  • arpc1b
  • LOC100410640
  • arpc1b.S
Alternatives
anti-Human ARPC1B antibody for ELISA
Reactivity
Human, Mouse (Murine), Rat (Rattus)
64
20
16
7
7
5
4
3
3
2
1
1
1
1
Host
Rabbit
46
18
Clonality
Polyclonal
Conjugate
This ARPC1B antibody is un-conjugated
4
4
4
3
3
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
55
41
16
12
4
2
2
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ARPC1B products on genomics-online (e.g. as negative or positive controls)
Alternative Name Actin-Related Protein 2/3 Complex Subunit 1B (ARPC1B Antibody Abstract)
Background Gene Symbol: ARPC1B
Molecular Weight Theoretical MW: 41 kDa
Gene ID 10095
UniProt O15143
Pathways RTK Signaling, Regulation of Actin Filament Polymerization
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody ...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in mo...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...
Product cited in: Somech, Lev, Lee, Simon, Barel, Schiby, Avivi, Barshack, Rhodes, Yin, Wang, Yang, Rhodes, Marcus, Garty, Stein, Amariglio, Rechavi, Wiest, Zhang: "Disruption of Thrombocyte and T Lymphocyte Development by a Mutation inARPC1B." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 199, Issue 12, pp. 4036-4045, 2017 (PubMed). (Sample species: Human).

Abella, Galloni, Pernier, Barry, Kjær, Carlier, Way: "Isoform diversity in the Arp2/3 complex determines actin filament dynamics." in: Nature cell biology, Vol. 18, Issue 1, pp. 76-86, 2015 (PubMed). (Sample species: Human). Further details: Immunocytochemistry,Western Blotting,Immunofluorescence

Did you look for something else?