Chromosome 9 Open Reading Frame 3 (C9orf3) antibody

Details for Product No. ABIN4280373
Antigen
  • apo
  • ap-o
  • aopep
  • MGC68599
  • Aopep
  • Apo
  • RGD1309592
  • AOPEP
  • AP-O
  • APO
  • C90RF3
  • ONPEP
  • 2300006M17Rik
  • chromosome 9 open reading frame 3 L homeolog
  • chromosome 9 open reading frame 3
  • aminopeptidase O
  • RIKEN cDNA 2010111I01 gene
  • c9orf3.L
  • c9orf3
  • Npepo
  • C9orf3
  • 2010111I01Rik
Reactivity
Human
23
Host
Rabbit
17
3
3
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
22
16
2
2
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ECSSWYYYVTMPMPASTFTIAVGCWTEMKMETWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name Aminopeptidase O/ONPEP (C9orf3 Antibody Abstract)
Background Gene Symbol: C9ORF3
Molecular Weight Theoretical MW: 94 kDa
Gene ID 84909
UniProt Q8N6M6
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Chromosome 9 Open Reading Frame 3 (C9orf3) antibody (ABIN4280373) Western Blot: aminopeptidase O Antibody [NBP1-89066] - Lane 1: Marker [kDa] 250, 130,...
Image no. 2 for anti-Chromosome 9 Open Reading Frame 3 (C9orf3) antibody (ABIN4280373) Immunohistochemistry-Paraffin: aminopeptidase O Antibody [NBP1-89066] - Staining of h...
Did you look for something else?