APOBEC3G antibody (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G)

Details for Product anti-APOBEC3G Antibody No. ABIN4281137
Antigen
  • A3G
  • ARCD
  • ARP-9
  • ARP9
  • CEM-15
  • CEM15
  • bK150C2.7
  • dJ494G10.1
  • apolipoprotein B mRNA editing enzyme catalytic subunit 3G
  • APOBEC3G
Reactivity
Human
161
9
8
2
Host
Rabbit
144
9
9
Clonality
Polyclonal
Conjugate
This APOBEC3G antibody is un-conjugated
12
11
11
9
9
9
2
2
2
2
2
2
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
126
94
78
18
13
8
4
3
2
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others APOBEC3G products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name APOBEC3G (APOBEC3G Antibody Abstract)
Background Gene Symbol: APOBEC3G
Gene ID 60489
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G) antibody (ABIN4281137) Western Blot: APOBEC3G Antibody [NBP1-88592] - Lane 1: Marker [kDa] 219, 112, 85, 49,...
Image no. 2 for anti-Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G) antibody (ABIN4281137) Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spl...
Image no. 3 for anti-Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G) antibody (ABIN4281137) Western Blot: APOBEC3G Antibody [NBP1-88592] - Lane 1: Marker [kDa] 219, 112, 85, 49,...
Image no. 4 for anti-Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G) antibody (ABIN4281137) Immunocytochemistry/Immunofluorescence: APOBEC3G Antibody [NBP1-88592] - Staining of ...
Product cited in: Sandler, Bosinger, Estes, Zhu, Tharp, Boritz, Levin, Wijeyesinghe, Makamdop, del Prete, Hill, Timmer, Reiss, Yarden, Darko, Contijoch, Todd, Silvestri, Nason, Norgren, Keele, Rao, Langer, Lifson et al.: "Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. ..." in: Nature, Vol. 511, Issue 7511, pp. 601-5, 2014 (PubMed).

Hansen, Piatak, Ventura, Hughes, Gilbride, Ford, Oswald, Shoemaker, Li, Lewis, Gilliam, Xu, Whizin, Burwitz, Planer, Turner, Legasse, Axthelm, Nelson, Früh, Sacha, Estes, Keele, Edlefsen, Lifson et al.: "Immune clearance of highly pathogenic SIV infection. ..." in: Nature, Vol. 502, Issue 7469, pp. 100-4, 2013 (PubMed).

Did you look for something else?