APOOL antibody (Apolipoprotein O-Like)

Details for Product anti-APOOL Antibody No. ABIN4281245
Antigen
  • 6720473G16Rik
  • 9430083G14Rik
  • E130106L15Rik
  • CXorf33
  • FAM121A
  • UNQ8193
  • RGD1549725
  • MGC130618
  • APOL
  • NV11613
  • DKFZp459K0210
  • apolipoprotein O-like
  • apolipoprotein O like
  • apolipoprotein O-like L homeolog
  • Apool
  • APOOL
  • apool.L
  • apool
Reactivity
Human, Mouse (Murine), Rat (Rattus)
47
19
10
2
Host
Rabbit
47
Clonality
Polyclonal
Conjugate
This APOOL antibody is un-conjugated
4
3
3
2
2
2
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
32
31
22
6
2
2
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others APOOL products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name APOOL (APOOL Antibody Abstract)
Background Gene Symbol: APOOL
Molecular Weight Theoretical MW: 29 kDa
Gene ID 139322
UniProt Q6UXV4
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Apolipoprotein O-Like (APOOL) antibody (ABIN4281245) Western Blot: APOOL Antibody [NBP1-89325] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32...
Image no. 2 for anti-Apolipoprotein O-Like (APOOL) antibody (ABIN4281245) Western Blot: APOOL Antibody [NBP1-89325] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Image no. 3 for anti-Apolipoprotein O-Like (APOOL) antibody (ABIN4281245) Western Blot: APOOL Antibody [NBP1-89325] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32...
Image no. 4 for anti-Apolipoprotein O-Like (APOOL) antibody (ABIN4281245) Immunohistochemistry-Paraffin: APOOL Antibody [NBP1-89325] - Staining of human stomac...
Image no. 5 for anti-Apolipoprotein O-Like (APOOL) antibody (ABIN4281245) Immunocytochemistry/Immunofluorescence: APOOL Antibody [NBP1-89325] - Staining of hum...
Product cited in: Weber, Koob, Heide, Wittig, Head, van der Bliek, Brandt, Mittelbronn, Reichert: "APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria." in: PLoS ONE, Vol. 8, Issue 5, pp. e63683, 2013 (PubMed).

Mulder, Björling, Jonasson, Wernérus, Hober, Hökfelt, Uhlén: "Tissue profiling of the mammalian central nervous system using human antibody-based proteomics." in: Molecular & cellular proteomics : MCP, Vol. 8, Issue 7, pp. 1612-22, 2009 (PubMed).

Mulder, Wernérus, Shi, Pontén, Hober, Uhlén, Hökfelt: "Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system." in: Neuroscience, Vol. 146, Issue 4, pp. 1689-703, 2007 (PubMed).

Did you look for something else?