ARHGAP12 antibody (rho GTPase Activating Protein 12)

Details for Product anti-ARHGAP12 Antibody No. ABIN4281494, Supplier: Log in to see
Antigen
  • MGC52929
  • arhgap12
  • zgc:73239
  • 2810011M08Rik
  • Rho GTPase activating protein 12 S homeolog
  • Rho GTPase activating protein 12b
  • Rho GTPase activating protein 12
  • arhgap12.S
  • arhgap12b
  • ARHGAP12
  • Arhgap12
Reactivity
Human, Mouse (Murine), Rat (Rattus)
10
2
2
1
1
1
1
Host
Rabbit
7
3
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
9
7
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ARHGAP12 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name ARHGAP12 (ARHGAP12 Antibody Abstract)
Background Gene Symbol: ARHGAP12
Molecular Weight Theoretical MW: 96 kDa
Gene ID 94134
UniProt Q8IWW6
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin, HIER pH 6 retrieval method is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human sto...
Western Blotting (WB) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Western Blot: ARHGAP12 Antibody [NBP1-91678] - Lane 1: Marker [kDa] 250, 130, 95, 72,...
Western Blotting (WB) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Western Blot: ARHGAP12 Antibody [NBP1-91678] - Lane 1: Marker [kDa] 250, 130, 95, 72,...
Western Blotting (WB) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Western Blot: ARHGAP12 Antibody [NBP1-91678] - Lane 1: NIH-3T3 cell lysate (Mouse emb...
Western Blotting (WB) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Western Blot: ARHGAP12 Antibody - Analysis in mouse cell line NIH-3T3 and rat cell l...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Immunohistochemistry-Paraffin: ARHGAP12 Antibody - Staining in human stomach and ske...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-rho GTPase Activating Protein 12 (ARHGAP12) antibody (ABIN4281494) Immunohistochemistry-Paraffin: ARHGAP12 Antibody - Staining of human skeletal muscle...
Product cited in: Schlam, Bagshaw, Freeman, Collins, Pawson, Fairn, Grinstein: "Phosphoinositide 3-kinase enables phagocytosis of large particles by terminating actin assembly through Rac/Cdc42 GTPase-activating proteins." in: Nature communications, Vol. 6, pp. 8623, 2015 (PubMed). (Sample species: Human). Further details: Western Blotting

Did you look for something else?