ARID5B antibody (AT Rich Interactive Domain 5B (MRF1-Like))

Details for Product anti-ARID5B Antibody No. ABIN4281577
Antigen
  • ARID5B
  • DKFZp469H121
  • DKFZP469L1210
  • DESRT
  • MRF-2
  • MRF2
  • 4930580B11
  • 5430435G07Rik
  • AI467247
  • Desrt
  • Mrf2
  • Mrf2alpha
  • Mrf2beta
  • AT-rich interaction domain 5B
  • AT-rich interaction domain 5B S homeolog
  • AT rich interactive domain 5B (MRF1-like)
  • ARID5B
  • arid5b.S
  • Arid5b
Reactivity
Human, Mouse (Murine)
27
4
4
4
4
3
3
2
2
1
1
1
Host
Rabbit
26
1
Clonality
Polyclonal
Conjugate
This ARID5B antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
26
15
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ARID5B products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name ARID5B (ARID5B Antibody Abstract)
Background Gene Symbol: ARID5B
Gene ID 84159
Pathways Platelet-derived growth Factor Receptor Signaling
Application Notes Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-AT Rich Interactive Domain 5B (MRF1-Like) (ARID5B) antibody (ABIN4281577) Western Blot: ARID5B Antibody [NBP1-83622] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Image no. 2 for anti-AT Rich Interactive Domain 5B (MRF1-Like) (ARID5B) antibody (ABIN4281577) Immunocytochemistry/Immunofluorescence: ARID5B Antibody [NBP1-83622] - Staining of hu...
Image no. 3 for anti-AT Rich Interactive Domain 5B (MRF1-Like) (ARID5B) antibody (ABIN4281577) Immunohistochemistry-Paraffin: ARID5B Antibody [NBP1-83622] - Staining of human cereb...
Product cited in: Xu, Zhao, Bhojwani, E, Goodings, Zhang, Seibel, Yang, Li, Carroll, Evans, Yang: "ARID5B Influences Antimetabolite Drug Sensitivity and Prognosis of Acute Lymphoblastic Leukemia." in: Clinical cancer research : an official journal of the American Association for Cancer Research, Vol. 26, Issue 1, pp. 256-264, 2020 (PubMed). Method employed by authors: Chromatin Immunoprecipitation (ChIP) (Sample species: Human).

Cichocki, Wu, Zhang, Felices, Tesi, Tuininga, Dougherty, Taras, Hinderlie, Blazar, Bryceson, Miller: "ARID5B regulates metabolic programming in human adaptive NK cells." in: The Journal of experimental medicine, Vol. 215, Issue 9, pp. 2379-2395, 2018 (PubMed). Method employed by authors: Western Blotting (WB), Chromatin Immunoprecipitation (ChIP) (Sample species: Human).

Nestor, Ottaviano, Reinhardt, Cruickshanks, Mjoseng, McPherson, Lentini, Thomson, Dunican, Pennings, Anderton, Benson, Meehan: "Rapid reprogramming of epigenetic and transcriptional profiles in mammalian culture systems." in: Genome biology, Vol. 16, pp. 11, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunocytochemistry,Immunofluorescence

Hata, Takashima, Amano, Ono, Nakanishi, Yoshida, Wakabayashi, Matsuda, Maeda, Suzuki, Sugano, Whitson, Nishimura, Yoneda: "Arid5b facilitates chondrogenesis by recruiting the histone demethylase Phf2 to Sox9-regulated genes." in: Nature communications, Vol. 4, pp. 2850, 2013 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunohistochemistry (Paraffin-embedded Sections)

Did you look for something else?