Ataxin 2 antibody (ATXN2)

Details for Product anti-ATXN2 Antibody No. ABIN4281955, Supplier: Log in to see
Antigen
  • ATXN2
  • MGC115230
  • ASL13
  • ATX2
  • SCA2
  • TNRC13
  • 9630045M23Rik
  • AW544490
  • Sca2
  • ataxin 2
  • ataxin 2 L homeolog
  • ataxin 2 like
  • ATXN2
  • atxn2.L
  • Atxn2
  • ATXN2L
Alternatives
anti-Human Ataxin 2 antibody for Immunoprecipitation
Reactivity
Human
65
36
31
8
7
5
5
4
3
2
2
1
1
Host
Rabbit
51
12
2
Clonality
Polyclonal
Conjugate
This Ataxin 2 antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
40
24
13
9
7
7
4
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Ataxin-2 (ATXN2 Antibody Abstract)
Background Gene Symbol: ATXN2
Gene ID 6311
Pathways Ribonucleoprotein Complex Subunit Organization
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Ataxin 2 (ATXN2) antibody (ABIN4281955) Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90062] Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ataxin 2 (ATXN2) antibody (ABIN4281955) Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90062] - Immunohistochemical s...
Product cited in: Kaehler, Isensee, Nonhoff, Terrey, Hucho, Lehrach, Krobitsch: "Ataxin-2-like is a regulator of stress granules and processing bodies." in: PLoS ONE, Vol. 7, Issue 11, pp. e50134, 2012 (PubMed).

Did you look for something else?