AUTS2 antibody (Autism Susceptibility Candidate 2)

Details for Product anti-AUTS2 Antibody No. ABIN4282487, Supplier: Log in to see
Antigen
  • FBRSL2
  • 2700063G02Rik
  • A730011F23Rik
  • D830032G16Rik
  • si:ch211-103d22.3
  • si:zc103d22.3
  • wu:fj83b10
  • RGD1561188
  • fbrsl2
  • AUTS2, activator of transcription and developmental regulator
  • autism susceptibility candidate 2
  • autism susceptibility candidate 2a
  • AUTS2
  • Auts2
  • auts2a
  • auts2
Reactivity
Human
38
25
18
4
1
1
1
1
1
1
Host
Rabbit
25
14
Clonality
Polyclonal
Conjugate
This AUTS2 antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
15
13
13
4
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADR
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others AUTS2 products on genomics-online (e.g. as negative or positive controls)
Antigen Autism Susceptibility Candidate 2 (AUTS2)
Alternative Name AUTS2
Background Gene Symbol: AUTS2
Gene ID 26053
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody [NBP1-84717] - Staining of human gall b...
Immunofluorescence (IF) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunocytochemistry/Immunofluorescence: AUTS2 Antibody [NBP1-84717] - Staining of hum...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody - Staining of human skeletal muscle sh...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody - Staining of human cerebral cortex sh...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody - Staining of human skin shows moderat...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody - Staining of human prostate shows wea...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Autism Susceptibility Candidate 2 (AUTS2) antibody (ABIN4282487) Immunohistochemistry-Paraffin: AUTS2 Antibody - Staining in human cerebral cortex an...
Product cited in: Oksenberg, Haliburton, Eckalbar, Oren, Nishizaki, Murphy, Pollard, Birnbaum, Ahituv: "Genome-wide distribution of Auts2 binding localizes with active neurodevelopmental genes." in: Translational psychiatry, Vol. 4, pp. e431, 2014 (PubMed). (Sample species: Mouse (Murine)). Further details: Chromatin Immunoprecipitation

Lancaster, Renner, Martin, Wenzel, Bicknell, Hurles, Homfray, Penninger, Jackson, Knoblich: "Cerebral organoids model human brain development and microcephaly." in: Nature, Vol. 501, Issue 7467, pp. 373-9, 2013 (PubMed).

Bedogni, Hodge, Nelson, Frederick, Shiba, Daza, Hevner: "Autism susceptibility candidate 2 (Auts2) encodes a nuclear protein expressed in developing brain regions implicated in autism neuropathology." in: Gene expression patterns : GEP, Vol. 10, Issue 1, pp. 9-15, 2010 (PubMed).

Ek, Andréasson, Hober, Kampf, Pontén, Uhlén, Merz, Borrebaeck: "From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies." in: Molecular & cellular proteomics : MCP, Vol. 5, Issue 6, pp. 1072-81, 2006 (PubMed).

Did you look for something else?