BRWD3 antibody (Bromodomain and WD Repeat Domain Containing 3)

Details for Product anti-BRWD3 Antibody No. ABIN4285436, Supplier: Log in to see
Antigen
  • CG18670
  • CG31132
  • CG6400
  • Dmel\\CG31132
  • anon-WO0118547.520
  • anon-WO0118547.620
  • dBRWD3
  • l(3)05842
  • l(3)s5349
  • ram
  • BRODL
  • MRX93
  • Brodl
  • D030064D06Rik
  • Gm596
  • RGD1559445
  • bromodomain and WD repeat domain containing 3
  • CG31132 gene product from transcript CG31132-RA
  • PH-interacting protein
  • BRWD3
  • LOC412406
  • Brwd3
Reactivity
Human
24
21
16
Host
Rabbit
24
Clonality
Polyclonal
Conjugate
This BRWD3 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
13
12
9
8
5
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others BRWD3 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name BRWD3 (BRWD3 Antibody Abstract)
Background Gene Symbol: BRWD3
Gene ID 254065
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This antibody is useful in Immunohistochemistry-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Bromodomain and WD Repeat Domain Containing 3 (BRWD3) antibody (ABIN4285436) Immunocytochemistry/Immunofluorescence: BRWD3 Antibody [NBP1-93796] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bromodomain and WD Repeat Domain Containing 3 (BRWD3) antibody (ABIN4285436) Immunohistochemistry-Paraffin: BRWD3 Antibody [NBP1-93796] - Staining of human gall b...
Did you look for something else?